DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and CG11309

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_649301.1 Gene:CG11309 / 40356 FlyBaseID:FBgn0037070 Length:358 Species:Drosophila melanogaster


Alignment Length:368 Identity:83/368 - (22%)
Similarity:130/368 - (35%) Gaps:102/368 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 KQYKTEIQGLNIHYIHEKVSEEAKEKKHVYPLLLLHGWPGSVREFFDFIPMLTKHSNITDYAFEV 190
            |:|..|| .:.:.:.|  :|.:....::|.|:|.||||..:...|...:|:|:     .|.||  
  Fly    42 KKYFAEI-SITVPWGH--ISGKWYGPQNVQPILGLHGWQDNAGTFDRLMPLLS-----PDVAF-- 96

  Fly   191 VAPSLVGYGWSDAATRPG---FNAAEMATVMRNLMLRLGHKKFFIQGGDWGSIIGSNLATLYPEN 252
            :|..|.|:|.|  :..|.   :|:.:...|:|.:|.:...:|..:.|....|||....|.::|:.
  Fly    97 LAIDLPGHGLS--SRLPDGCYYNSVDNLYVIRLIMKQYKWEKVSLVGHSMSSIICFVFAAVFPDK 159

  Fly   253 V---IG----------YHSNMCVLHTPLAILKGIYGSFFPE------KYLPSRFFVDHHFPVWEK 298
            |   ||          |.|.:..:.|.|       ..|..|      |..|..:..|        
  Fly   160 VDMIIGIDALKPHQRPYPSVIRTMETRL-------DEFLREDERNRSKNEPPSYTYD-------- 209

  Fly   299 WLELLEE--SGYFHIQATKPDTIGAALTSSPVGLASYILEKFQTCTNPGLKQDFGAIVTVFGLEA 361
              ||:|.  .|.|| ...|...  ..|.:..:|.:....:|:..|.:..||         |...|
  Fly   210 --ELIERVYIGTFH-SVNKEHC--KHLMARNIGKSEKYPDKYFFCRDRRLK---------FYNYA 260

  Fly   362 VLDNLMVYYLTNSAT-------TAARFYLENVSKTYRDLQLDRVQSPVPMGCARFRFDLASVTDW 419
            :....:...:.|..|       .|...|.|:  |.|.|..||.:.                    
  Fly   261 IGSQELCVEMANRITCPYLFIKAAQSSYFED--KKYYDEVLDVLL-------------------- 303

  Fly   420 QLRDKFPNLTHSMYFQ-QGSHFAALEMPAMLFNDFTAFVGKIG 461
                |.||..   |.: .|||...:..|..:......|:.:.|
  Fly   304 ----KKPNFE---YLEVNGSHHVHMNDPEAIIAPVNNFIQRFG 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 13/38 (34%)
Abhydrolase 135..>251 CDD:304388 31/118 (26%)
CG11309NP_649301.1 MhpC 68..337 CDD:223669 75/335 (22%)
Abhydrolase_5 73..>158 CDD:289465 26/93 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.