DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and SPAC22H12.03

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001342787.1 Gene:SPAC22H12.03 / 2541745 PomBaseID:SPAC22H12.03 Length:270 Species:Schizosaccharomyces pombe


Alignment Length:267 Identity:49/267 - (18%)
Similarity:85/267 - (31%) Gaps:112/267 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 EKVSEEAKEKKHVYPLLLLHGWPGSVREFFDFIPMLTKHSNITDYAFE--------VVAP----- 193
            ||.|  |...||. |:|:.||..||.|.:.......:...:...||.:        .|||     
pombe    11 EKYS--ATVAKHP-PVLIFHGLLGSKRNWRSLAKKFSCKLDRDIYAIDQRCHGDSPCVAPLSYSA 72

  Fly   194 -----------------SLVGYG------------WS---------------------------- 201
                             |::|:.            |.                            
pombe    73 MALDAFQFMKDHKLDKASIIGHSMGAKTAMVTALKWPDKVEKLVVVDNSPWYQDLPRDYGAYFRK 137

  Fly   202 ----DAATRPGFNAAE--MATVMRNLMLRLGHKKFFIQGGDWGS-------------IIGSNLAT 247
                |.|....::.|:  |:||.:::::|    .|.:......|             :|..:|.|
pombe   138 MIQIDEANITKYSEADKMMSTVEKDILVR----SFLLSNLKKDSNNSNTFKFRVPIELISKSLKT 198

  Fly   248 L--YPENVIGYHSNMCVLHTPLAILKGIYGSFFPEKYLP--SRFFVDHHFPVWEKWLELLEESGY 308
            :  :|.::     |..|..:|..:::.:...|.|:..||  .:|     ||.:|  |..|:...:
pombe   199 IEGFPASL-----NDLVYDSPTLVIRALKAPFIPDSALPVFKKF-----FPKYE--LVSLDCGHW 251

  Fly   309 FHIQATK 315
            .|.:..|
pombe   252 VHFEKPK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 10/22 (45%)
Abhydrolase 135..>251 CDD:304388 33/199 (17%)
SPAC22H12.03NP_001342787.1 PRK10673 13..269 CDD:331147 47/265 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.