DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and EPHX4

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_775838.3 Gene:EPHX4 / 253152 HGNCID:23758 Length:362 Species:Homo sapiens


Alignment Length:325 Identity:74/325 - (22%)
Similarity:117/325 - (36%) Gaps:81/325 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GLNIHYIHEKVSEEAKEKKHVYPL-LLLHG-------WPGSVREFFDFIPMLTKHSNITDYAFEV 190
            ||..||:  ...|..|      || |||||       |...:|||              ...:.|
Human    80 GLRFHYV--AAGERGK------PLMLLLHGFPEFWYSWRYQLREF--------------KSEYRV 122

  Fly   191 VAPSLVGYGWSDAAT-RPGFNAAEMATVMRNLMLRLGHKKFFIQGGDWGSIIGSNLATLYPENVI 254
            ||..|.|||.:||.. |..:....:.|.:::::..||:.|..:.|.|||.:|...:|..|||.|:
Human   123 VALDLRGYGETDAPIHRQNYKLDCLITDIKDILDSLGYSKCVLIGHDWGGMIAWLIAICYPEMVM 187

  Fly   255 GY------HSNM---CVLHTPLAILKGIYGSFFPEKYLPSRFFVDHHFPVWEKWLELLEESGYFH 310
            ..      |.|:   .:|..|..:||..|..||...:.|...|..:.|.|.:.         .|.
Human   188 KLIVINFPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKH---------LFT 243

  Fly   311 IQATKPDTIGAALTSSPVGLASYILEKFQTCTNPGLKQDFGAIVTVFGLEAVLDNLMVYY----- 370
            ..:|.....|..||:                      :|..|.:.||.....|...:.:|     
Human   244 SHSTGIGRKGCQLTT----------------------EDLEAYIYVFSQPGALSGPINHYRNIFS 286

  Fly   371 ---LTNSATTAARFYLENVSKTYRDLQLDRVQSPVPMGCARFRFDLASVTDWQLRDKFPNLTHSM 432
               |.:...|.....|...:..:.::::..|.........|... |:..:.|..:|: |::.:.:
Human   287 CLPLKHHMVTTPTLLLWGENDAFMEVEMAEVTKIYVKNYFRLTI-LSEASHWLQQDQ-PDIVNKL 349

  Fly   433  432
            Human   350  349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 14/38 (37%)
Abhydrolase 135..>251 CDD:304388 37/124 (30%)
EPHX4NP_775838.3 MhpC 76..350 CDD:223669 74/325 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2361
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.