DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and ceeh-1

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_497268.1 Gene:ceeh-1 / 175239 WormBaseID:WBGene00019329 Length:404 Species:Caenorhabditis elegans


Alignment Length:386 Identity:76/386 - (19%)
Similarity:125/386 - (32%) Gaps:127/386 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 RDNYLTKWDERQELFNSFKQYKTEIQGLNIHYIHEKVSEEAKEKKHVYPLLL-LHGWPG------ 165
            :.|.|..||.|.          .:::.:.:||:.....::        ||:| :||:|.      
 Worm   110 KPNVLEGWDSRY----------IKLKKVRLHYVQTGSDDK--------PLMLFIHGYPEFWYSWR 156

  Fly   166 -SVREFFDFIPMLTKHSNITDYAFEVVAPSLVGYGWSDAATRP----GFNAAEMATVMRNLMLRL 225
             .::||.|              .:..||....||..||   :|    .::..|:...:|:::..|
 Worm   157 FQLKEFAD--------------KYRCVAIDQRGYNLSD---KPKHVDNYSIDELTGDIRDVIEGL 204

  Fly   226 GHKKFFIQGGDWGSIIGSNLATLYPENV---IGYHSNMCVLHTPLAILKGIYGS----------- 276
            |:.|..:...|||.::....|..|||.|   |     .|.:..|.:..|.||.|           
 Worm   205 GYDKAIVVAHDWGGLVAWQFAEQYPEMVDKLI-----CCNIPRPGSFRKRIYTSWSQFRKSWYMF 264

  Fly   277 FFPEKYLPSRFFVDHHFPVWEKWLELLEESGYFHIQATKPDTIGAALTSSPVGLASYILEKFQTC 341
            |:..:.:|.........    |.|||...:....||..|..|                       
 Worm   265 FYQNEKIPEMLCSADDM----KMLELCFRAKEIGIQNNKNFT----------------------- 302

  Fly   342 TNPGLKQDFGAIVTVFGLEAVLDNLMVYYLTNSATTAARFYLENVSKTYRDLQLDRVQSPVPMGC 406
                 .:|..|....|.:........:.|..|         :.|..|...||.|: :.:.:..|.
 Worm   303 -----DEDLEAWKYSFSMNGASFKYPINYYRN---------IFNAKKQQADLVLE-MPTLIIWGT 352

  Fly   407 ARFRFDLASVTDWQLRDKFPNLTHSMYFQQG--------SHFAALEMPAMLFNDFTAFVGK 459
            |....|:.:..|        :|.   ..:||        ||:...:.|.|:......|:.|
 Worm   353 ADGALDIEAAVD--------SLN---TLKQGTMKKIEGASHWVQQDEPEMVNEHIKKFLNK 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 12/57 (21%)
Abhydrolase 135..>251 CDD:304388 28/127 (22%)
ceeh-1NP_497268.1 MhpC 119..400 CDD:223669 70/373 (19%)
Abhydrolase 128..>257 CDD:304388 38/158 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2361
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.