DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Jheh3 and AgaP_AGAP009289

DIOPT Version :9

Sequence 1:	NP_611387.1	Gene:	Jheh3 / 37182	FlyBaseID:	FBgn0034406	Length:	468	Species:	Drosophila melanogaster
Sequence 2:	XP_320086.3	Gene:	AgaP_AGAP009289 / 1280255	VectorBaseID:	AGAP009289	Length:	328	Species:	Anopheles gambiae

Alignment Length:	49	Identity:	15/49 - (30%)
Similarity:	21/49 - (42%)	Gaps:	4/49 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    21 GYVVFTELTKPLPKPEFKDDTYWGPGDAKDFVPDEKIYEFKLQVPQSEI 69
            |...|.:||    ..:|:..|.:..|...|:|..|.:...|...|.|||
Mosquito   256 GVAQFPQLT----GRKFEGPTLFIAGGRSDYVKSEDVPLIKTLFPNSEI 300

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Jheh3	NP_611387.1	EHN	60..165	CDD:283978	5/10 (50%)
Jheh3	NP_611387.1	Abhydrolase	135..>251	CDD:304388
AgaP_AGAP009289	XP_320086.3	PRK10673	36..328	CDD:182637	15/49 (31%)
AgaP_AGAP009289	XP_320086.3	Abhydrolase_5	49..>137	CDD:289465
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910