powered by:
Protein Alignment Jheh3 and AgaP_AGAP009289
DIOPT Version :9
Sequence 1: | NP_611387.1 |
Gene: | Jheh3 / 37182 |
FlyBaseID: | FBgn0034406 |
Length: | 468 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_320086.3 |
Gene: | AgaP_AGAP009289 / 1280255 |
VectorBaseID: | AGAP009289 |
Length: | 328 |
Species: | Anopheles gambiae |
Alignment Length: | 49 |
Identity: | 15/49 - (30%) |
Similarity: | 21/49 - (42%) |
Gaps: | 4/49 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 GYVVFTELTKPLPKPEFKDDTYWGPGDAKDFVPDEKIYEFKLQVPQSEI 69
|...|.:|| ..:|:..|.:..|...|:|..|.:...|...|.|||
Mosquito 256 GVAQFPQLT----GRKFEGPTLFIAGGRSDYVKSEDVPLIKTLFPNSEI 300
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.