DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and AgaP_AGAP008167

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_317294.4 Gene:AgaP_AGAP008167 / 1277796 VectorBaseID:AGAP008167 Length:351 Species:Anopheles gambiae


Alignment Length:178 Identity:39/178 - (21%)
Similarity:72/178 - (40%) Gaps:46/178 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 EQFVDYWRDNYLTKWDERQE-----LFNSFKQYKTEI---QGLNIHYIHEKVSEEA--KEKKHVY 155
            ::.:..|......|.:|.:|     |...|:....|:   .|.|     :|:...|  :|.::: 
Mosquito    22 QRLLHKWTRYSSAKLEEVEETLLSALRKPFESIFVEVGQCVGTN-----DKIRTVALNRESENI- 80

  Fly   156 PLLLLHG-------WPGSVREFFDFIPMLTKHSNITDYAFEVVAPSLVGYGWSDAATRPGFN--- 210
            |:|||||       |..::....|..||         ||.::     :|:|.|   :.|.::   
Mosquito    81 PVLLLHGLGAGVGLWVLNLDAIADHRPM---------YAIDI-----LGFGRS---SHPKYDEDP 128

  Fly   211 -AAEMATV--MRNLMLRLGHKKFFIQGGDWGSIIGSNLATLYPENVIG 255
             |||...|  :....:.:|.::.:|.|...|..:..:....:|:.|.|
Mosquito   129 IAAERQFVASIEAWRVAMGLERMYILGHSMGGYLACSYTITHPQRVAG 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 19/80 (24%)
Abhydrolase 135..>251 CDD:304388 28/130 (22%)
AgaP_AGAP008167XP_317294.4 PLN02894 4..351 CDD:215484 39/178 (22%)
Abhydrolase_5 81..>193 CDD:289465 27/113 (24%)
Abhydrolase <151..339 CDD:304388 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.