DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and ephx4

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_002933851.2 Gene:ephx4 / 100492111 XenbaseID:XB-GENE-983897 Length:361 Species:Xenopus tropicalis


Alignment Length:180 Identity:50/180 - (27%)
Similarity:70/180 - (38%) Gaps:40/180 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GLNIHYIHEKVSEEAKEKKHVYPL-LLLHG-------WPGSVREFFDFIPMLTKHSNITDYAFEV 190
            ||..||:  ...|..|      || |||||       |...:|||              ...:.|
 Frog    78 GLRFHYV--AAGERGK------PLMLLLHGFPEFWYSWRHQLREF--------------KSEYRV 120

  Fly   191 VAPSLVGYGWSDAATRPGFNAAEMATV-MRNLMLRLGHKKFFIQGGDWGSIIGSNLATLYPENVI 254
            ||..|.|||.:||.|.......:...| ::.::..||:.|..:.|.|||.:|....|..|||.|.
 Frog   121 VALDLRGYGETDAPTNIDSYKLDCIIVDVKEIVDSLGYTKCVLIGHDWGGMIAWLTAICYPEMVT 185

  Fly   255 GY------HSNM---CVLHTPLAILKGIYGSFFPEKYLPSRFFVDHHFPV 295
            ..      |..:   .:|..|..::|..|..||...:.|...:..:.:.|
 Frog   186 KLIVLSFPHPTVFTEYILRHPSQLIKSGYYFFFQMPWFPELMYTVNDYKV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 14/38 (37%)
Abhydrolase 135..>251 CDD:304388 37/124 (30%)
ephx4XP_002933851.2 Abhydrolase 64..>189 CDD:304388 41/132 (31%)
MhpC 78..348 CDD:223669 50/180 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2361
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.