DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jheh3 and ephx4

DIOPT Version :9

Sequence 1:NP_611387.1 Gene:Jheh3 / 37182 FlyBaseID:FBgn0034406 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_002662469.1 Gene:ephx4 / 100331939 ZFINID:ZDB-GENE-080227-1 Length:370 Species:Danio rerio


Alignment Length:352 Identity:88/352 - (25%)
Similarity:134/352 - (38%) Gaps:87/352 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GLNIHYIHEKVSEEAKEKKHVYPLLL-LHGWPGSVREF-FDFIPMLTKHSNITDYAFEVVAPSLV 196
            ||..||:  ...|..|      ||:| |||:|    || |.:...|.:..:    .|.|||..:.
Zfish    84 GLRFHYV--AAGERGK------PLMLFLHGFP----EFWFSWRHQLREFKS----EFRVVAVDMR 132

  Fly   197 GYGWSD-AATRPGFNAAEMATVMRNLMLRLGHKKFFIQGGDWGSIIGSNLATLYPENVIGYHSNM 260
            |||.|| .::...:....:.|.:::::..||:.:.|:.|.|||.||....|..|||.|    :.:
Zfish   133 GYGESDLPSSTESYRLDYLVTDIKDIVEYLGYNRCFLVGHDWGGIIAWLCAIHYPEMV----TKL 193

  Fly   261 CVLHTPLAILKGIYGSFFPEKYLPSRFFVDHHFPVWEKWLELLEESGYFHIQATKPDTIGAALTS 325
            .||::|...:...|....|.:.|.|.::.....|.:.:.:..:.:     .:|.|     :..||
Zfish   194 IVLNSPHPCVFTDYALRHPSQMLKSSYYFFFQLPYFPELMLSIND-----FKALK-----SLFTS 248

  Fly   326 SPVGLASYILEKFQTCTNPGLKQDFGAIVTVFGLEAVLDNLMVYYLTN-SATTAARFYLENVSKT 389
            ...|:         :|.        |..:|...|||.|     |.|:. .|.|.|..|..||...
Zfish   249 RSTGI---------SCK--------GRWLTTEDLEAYL-----YALSQPGALTGALNYFRNVFSV 291

  Fly   390 YRDLQLDRVQSPVPMGCARFRFDLASVTDWQLRDKF-------------PNLTHSMYFQQGSHFA 441
            . .|....|:|||             :..|..||.|             .||.........||:.
Zfish   292 L-PLSHSEVKSPV-------------LLLWGERDAFLEQDMAEACRLYIRNLFRLNIISGASHWL 342

  Fly   442 ALEMPAMLFNDFTAFVGKIGLHGEKRK 468
            ..:.|.::......|:.:    ||.||
Zfish   343 QQDQPDIVNKLIWTFIKE----GEGRK 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jheh3NP_611387.1 EHN 60..165 CDD:283978 12/31 (39%)
Abhydrolase 135..>251 CDD:304388 37/118 (31%)
ephx4XP_002662469.1 MhpC 80..354 CDD:223669 83/335 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.