DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JAK3 and Src42A

DIOPT Version :9

Sequence 1:NP_000206.2 Gene:JAK3 / 3718 HGNCID:6193 Length:1124 Species:Homo sapiens
Sequence 2:NP_610191.2 Gene:Src42A / 35524 FlyBaseID:FBgn0264959 Length:1597 Species:Drosophila melanogaster


Alignment Length:296 Identity:105/296 - (35%)
Similarity:156/296 - (52%) Gaps:29/296 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   812 QDPTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILK 876
            :|....:...||::.:||.|.||.|    ::.|.:|| ..||:|.|: ||....:||..|.||:|
  Fly  1318 RDQWEIDRTSLKFVRKLGSGQFGDV----WEGLWNNT-TPVAIKTLK-SGTMDPKDFLAEAQIMK 1376

Human   877 AL-HSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRAR---LDASRLLLYSSQICKGM 937
            .| |:..|..|...:.   .:.:.::.|.:..|.|.::||....:   |....|:..::||..||
  Fly  1377 KLRHTKLIQLYAVCTV---EEPIYIITELMKHGSLLEYLQAIAGKGRSLKMQTLIDMAAQIAAGM 1438

Human   938 EYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDN 1002
            .||.|:..:||||||||:||.....|||||||||:|  :.:|.|..|...:.||.|.|||:.:.:
  Fly  1439 AYLESQNYIHRDLAARNVLVGDGNIVKIADFGLARL--IKEDEYEARVGARFPIKWTAPEAANYS 1501

Human  1003 IFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACP 1067
            .||.:|||||||::|.||.||      ....:..|...|        :|..:|.|.|:|.||.|.
  Fly  1502 KFSIKSDVWSFGILLTELVTY------GRIPYPGMTNAE--------VLTQVEHGYRMPQPPNCE 1552

Human  1068 AEVHELMKLCWAPSPQDRPSFSALGPQLDMLWSGSR 1103
            ..::|:|..||...|..||:|..|..:|:..::..:
  Fly  1553 PRLYEIMLECWHKDPMRRPTFETLQWKLEDFYTSDQ 1588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JAK3NP_000206.2 Interaction with cytokine/interferon/growth hormone receptors. /evidence=ECO:0000250 1..223
B41 39..>200 CDD:214604
PH-like 250..362 CDD:302622
SH2_Jak3 362..458 CDD:198243
PTK_Jak3_rpt1 521..778 CDD:271110
Pkinase_Tyr 521..777 CDD:285015
PTKc_Jak3_rpt2 817..1099 CDD:270665 104/285 (36%)
Pkinase_Tyr 822..1095 CDD:285015 103/276 (37%)
Src42ANP_610191.2 SH2_Src_Src42 1210..1301 CDD:198233
PTKc_Frk_like 1319..1587 CDD:270653 105/292 (36%)
Pkinase_Tyr 1328..1580 CDD:285015 103/276 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.