DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and EB1C

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_201528.1 Gene:EB1C / 836862 AraportID:AT5G67270 Length:329 Species:Arabidopsis thaliana


Alignment Length:260 Identity:72/260 - (27%)
Similarity:117/260 - (45%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTAKLEHEYLHNLRLFQ 82
            :.|.::|.|:|:.:..:..|:||.||||.:||:|:.:.|..:.:.:|...||.|:|.:.|.::.|
plant    14 VGRSEILAWINSTLQLNLSKVEEACSGAVHCQLMDSVHPGTVPMHKVNFDAKSEYEMIQNYKVLQ 78

  Fly    83 EAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLENIKSLANAPLAK--------- 138
            :.||:||:.|.:.:.:|:|||..||.||:||.||:.||...|..|..:|.....:|         
plant    79 DVFNKLKITKHIEVSKLVKGRPLDNLEFMQWMKKYCDSVNGGQHNYHALERREASKGGKEATKRA 143

  Fly   139 --------------PIKP------------------------------RQFAKERSPVNANDDAL 159
                          |.:|                              :..||:..||.|.|:.:
plant   144 AATQQSGKSSSSSAPPRPSSSNGTRKHEPQSNNTGTHHSSTGNHHHSSKPSAKQSKPVPAYDEKI 208

  Fly   160 KEL---IDEMKNLSLKREDIMEASNQIYNKLRLVEDLVNDMINNNQLVELCKRIQAVLYKTIDGE 221
            .||   ||.::    |..|.      .::|||.||.|..:  .:.:.:.|...|:.:|| ..|||
plant   209 TELKLYIDSLE----KERDF------YFSKLRDVEILCQN--PDTEHLPLVGSIKRILY-AADGE 260

  Fly   222  221
            plant   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 26/72 (36%)
EB1 184..216 CDD:281288 9/31 (29%)
EB1CNP_201528.1 BIM1 8..261 CDD:227542 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 103 1.000 Domainoid score I2253
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 1 1.000 - - mtm1038
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X303
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.