DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and EB1B

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_201056.1 Gene:EB1B / 836370 AraportID:AT5G62500 Length:293 Species:Arabidopsis thaliana


Alignment Length:270 Identity:84/270 - (31%)
Similarity:136/270 - (50%) Gaps:63/270 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTAKLEHEYLHNLRLFQ 82
            :.|:::|.|:|:.:|.:..:|||..|||..|||::|.||..:.:.:|...||.|:|.:.|.::.|
plant    14 VGRNEILSWINDRLHLNLSRIEEAASGAVQCQMLDMTFPGVVPMHKVNFEAKNEYEMIQNYKVMQ 78

  Fly    83 EAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLEN-------------------- 127
            |.|.:||:.|.:.::||:|||..||.|||||.|:|.||...|:.|                    
plant    79 EVFTKLKITKPLEVNRLVKGRPLDNLEFLQWLKRFCDSINGGIMNENYNPVERRSRGGREKSVKG 143

  Fly   128 ----IKSLA-----NAPLA---KPIKPRQFAKER-----SPVNANDDALKELIDEMKNLSLKRED 175
                .|||.     :.|:|   ||..|:| ||..     |..:|...||.:.::::| :|:   |
plant   144 SSKISKSLQTNNMHHPPVATSNKPAGPKQ-AKSHGIGGGSNSSAEVQALSKEVEDLK-VSV---D 203

  Fly   176 IMEASNQIY-NKLRLVEDL-----VNDMINNNQLVELCKRIQAVLYKTIDGEINEEPVE-----V 229
            ::|.....| :|||.:|.|     ::|:       .:...::.:||.|   :.||..:|     :
plant   204 LLEKERDFYFSKLRDIEILCQTPELDDL-------PIVVAVKKILYAT---DANESVLEEAQECL 258

  Fly   230 NEDNGDEGAE 239
            |:..|.||.|
plant   259 NQSLGLEGYE 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 28/72 (39%)
EB1 184..216 CDD:281288 8/37 (22%)
EB1BNP_201056.1 CH 16..113 CDD:278723 42/96 (44%)
EB1 206..243 CDD:281288 9/43 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 103 1.000 Domainoid score I2253
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 1 1.000 - - mtm1038
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.