DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and mapre3a

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_005158903.1 Gene:mapre3a / 559217 ZFINID:ZDB-GENE-050913-88 Length:273 Species:Danio rerio


Alignment Length:280 Identity:103/280 - (36%)
Similarity:154/280 - (55%) Gaps:46/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKLTVALTSVNAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTA 68
            :.:.|..|||..||:||||||.|||:.:...:.|||:|||||||||.|||:||.||.||:||..|
Zfish     1 MAVNVYSTSVTIENLSRHDMLAWVNDSLQLTYTKIEQLCSGAAYCQFMEMLFPGCILLKKVKFQA 65

  Fly    69 KLEHEYLHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLE--NIKSL 131
            |||||::||.::.|.||.|:.:||.:|::||:||:|||||||:||||||||:...|.|  .|::.
Zfish    66 KLEHEFIHNFKVLQAAFKRMNVDKIIPVERLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPIQAR 130

  Fly   132 ANAPLAKPIKP-RQFAKE-------------------------------RSPVNA----NDDALK 160
            ....:|.|..| ..|:.:                               ::|.:|    :|..:.
Zfish   131 QGQDVAPPPNPGEHFSHKPKRTGPSGPQRTSPTVPKNMPTPQRVTTTIRKNPTHARNGGSDAEIT 195

  Fly   161 ELIDEMKNLSLKREDIMEASNQIYNKLRLVEDLVNDMINNNQLVELCKRIQAVLYKTIDGEINEE 225
            ||..::..|.|..:.:.:..:..::|||.:|.:..|  :..:...:..||..:||.|.||....|
Zfish   196 ELNQQLMELKLTVDGLEKERDFYFSKLRDIELICQD--HEAESSPVISRIIDILYATEDGFAPPE 258

  Fly   226 PVEVNEDNGDEGAEHADPND 245
            ..|::|.:      |.|.::
Zfish   259 DDEIDEQS------HLDQDE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 44/72 (61%)
EB1 184..216 CDD:281288 8/31 (26%)
mapre3aXP_005158903.1 CH 16..114 CDD:278723 62/97 (64%)
EB1 212..249 CDD:281288 8/38 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594770
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.