DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and mapre2

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001103172.1 Gene:mapre2 / 557679 ZFINID:ZDB-GENE-071004-41 Length:343 Species:Danio rerio


Alignment Length:290 Identity:103/290 - (35%)
Similarity:153/290 - (52%) Gaps:61/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKLTVALTSVNAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTA 68
            :.:.|..||:..|.|||||:..|||:::..::.|:|:|.|||||||.|:|:||.||:||:||..|
Zfish    45 MAVNVYSTSITQETMSRHDITAWVNDLLCLNYTKVEQLSSGAAYCQFMDMLFPGCISLKKVKFQA 109

  Fly    69 KLEHEYLHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLE------- 126
            ||||||:||.:|.|.:|.|:.:||.:|:::|:|||||||.:|:||||||||:...|.|       
Zfish   110 KLEHEYIHNFKLLQASFKRMNVDKIIPVEKLVKGRFQDNLDFIQWFKKFFDANYDGKEYDPVEAR 174

  Fly   127 ----------------NI--KS--LANAPLAKPIK----------------PRQFAKERSPVNAN 155
                            |:  ||  .|::|.|...:                .|..:.::.||.:.
Zfish   175 QGQDAIPPPDPGEQIFNLPKKSHHAASSPTAGATRSTSSTPKSSTSTSTSTSRPSSAKKLPVMSA 239

  Fly   156 DDA---------LKELIDEMKNLSLKREDIMEASNQIYNKLRLVEDLVNDM-INNNQLVELCKRI 210
            ..|         :.:|.::|..|.|..|.:.:..:..:.|||.||.|..:. .:|...||   |:
Zfish   240 TPAKGEKELEAQVTQLNEQMNTLKLALEGVEKERDFYFGKLREVELLCQEQGQDNGPFVE---RL 301

  Fly   211 QAVLYKTID----GEINEEPVEVNEDNGDE 236
            ..|||...|    ||.:|.|.: .||..|:
Zfish   302 MEVLYSADDQEAGGEEHEAPAQ-EEDVPDD 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 40/72 (56%)
EB1 184..216 CDD:281288 12/32 (38%)
mapre2NP_001103172.1 BIM1 60..326 CDD:227542 95/269 (35%)
CH 60..144 CDD:278723 45/83 (54%)
EB1 270..307 CDD:281288 12/39 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594769
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.