DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and Eb1

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_724495.2 Gene:Eb1 / 35584 FlyBaseID:FBgn0027066 Length:297 Species:Drosophila melanogaster


Alignment Length:284 Identity:94/284 - (33%)
Similarity:145/284 - (51%) Gaps:68/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKLTVALTSVNAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTA 68
            :.:.|..|:|.:||:||||||.|||:.:...|.||||||:||||||.|:|:|||.:.:||||...
  Fly     1 MAVNVYSTNVTSENLSRHDMLAWVNDCLQSQFSKIEELCTGAAYCQFMDMLFPNSVPVKRVKFRT 65

  Fly    69 KLEHEYLHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLE------- 126
            .|||||:.|.::.|..|.::.:||.:|:|:|||||||||||||||||||||:...|.|       
  Fly    66 NLEHEYIQNFKILQAGFKKMSVDKIIPVDKLIKGRFQDNFEFLQWFKKFFDANYDGREYDPVAQR 130

  Fly   127 ------------------------NIKSLANAPLAKP------------------IKPR-QFAKE 148
                                    ::..:...||..|                  :.|| ..|..
  Fly   131 GGVKLGNGNGHGSNGGSGVGSSNNDLHLMHRRPLQAPASGGRMPARVIASTAVSKVLPRTNNAAP 195

  Fly   149 RSPVNA-----------------NDDALKELIDEMKNLSLKREDIMEASNQIYNKLRLVEDLVND 196
            .|.:||                 |:..::|:.:::.::.:..|.:.:..:..::|||.:|.|..:
  Fly   196 ASRINACANSTGTVKKNDVSNSVNNQQIEEMSNQVMDMRINLEGLEKERDFYFSKLRDIEILCQE 260

  Fly   197 MINNNQLVELCKRIQAVLYKTIDG 220
             .::.:...:.::|..:||.|.||
  Fly   261 -ADDAEAHPIIQKILDILYATEDG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 39/72 (54%)
EB1 184..216 CDD:281288 7/31 (23%)
Eb1NP_724495.2 BIM1 16..293 CDD:227542 89/269 (33%)
CH 16..114 CDD:278723 60/97 (62%)
EB1 241..279 CDD:281288 7/38 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468772
Domainoid 1 1.000 103 1.000 Domainoid score I2253
eggNOG 1 0.900 - - E1_COG5217
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100079at50557
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 1 1.000 - - mtm1038
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
98.850

Return to query results.
Submit another query.