DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and CG2955

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_608817.1 Gene:CG2955 / 33622 FlyBaseID:FBgn0031585 Length:565 Species:Drosophila melanogaster


Alignment Length:137 Identity:47/137 - (34%)
Similarity:77/137 - (56%) Gaps:8/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTAKLEHEYLHNL 78
            :..:.||..:|.|:||.:...:.::|||.:||.||:|:..:.|:.|.||||....|..:|.:.|:
  Fly     9 HGNSASRRRILGWINNNLGTTYVRLEELRTGAEYCRMLHKLQPSAIRLKRVFKEPKSHYECVQNM 73

  Fly    79 RLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLENIKSLANAPLAKPI--- 140
            :|.|::..:..::|.:||.||:.....::.||.||||.|:|.....|...|: .:||  ||:   
  Fly    74 KLLQKSLLKQGVEKQIPIQRLVSRGNSESLEFAQWFKAFYDHNHQLLWPEKT-EDAP--KPLEKF 135

  Fly   141 --KPRQF 145
              ||..|
  Fly   136 DEKPDSF 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 25/72 (35%)
EB1 184..216 CDD:281288
CG2955NP_608817.1 CH 14..99 CDD:278723 30/84 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468764
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.