DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and mapre1a

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_956158.2 Gene:mapre1a / 334135 ZFINID:ZDB-GENE-030131-6067 Length:272 Species:Danio rerio


Alignment Length:283 Identity:100/283 - (35%)
Similarity:145/283 - (51%) Gaps:59/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKLTVALTSVNAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTA 68
            :.:.|..|||.:||:||||||.|:|..:..:..|||:||:|||||..|:|:||:|:.||:||..|
Zfish     1 MAVNVFSTSVTSENLSRHDMLTWINESLQMNHAKIEQLCTGAAYCHFMDMLFPSCLPLKKVKFQA 65

  Fly    69 KLEHEYLHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLE------- 126
            ||||||:||.:|.|.:|.::.:.|.:|:|:|:||:|||||||:||||||||:...|.|       
Zfish    66 KLEHEYIHNFKLLQASFKKMGVSKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPVAAR 130

  Fly   127 -------NIKSLANA---------------PLAKPIKP----RQFAKERSP----------VNAN 155
                   |....|.|               |..||:.|    |..|..:|.          ..:.
Zfish   131 QGQDIPTNQSPAAAATANKARKPSSDTGITPAVKPMAPVAPQRSAAAPKSTAKTSPAATRGTGSG 195

  Fly   156 DD---ALKELIDEMKNLSLKREDIMEASNQIY-NKLRLVEDLVNDMINNNQLVELCKRIQAVLYK 216
            |:   ||.::|:::|.....    ||.....| .|||.:|.:..:......  ...::|..:||.
Zfish   196 DEEKGALTQMINDLKATIAD----MEKERDFYFGKLRNIELICQEKEGEGD--PTLQKIVDILYA 254

  Fly   217 TIDGEINEEPVEVNEDNGDEGAE 239
            |.:|.:      :.||.|.|..|
Zfish   255 TDEGFV------IPEDEGGEPEE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 39/72 (54%)
EB1 184..216 CDD:281288 7/32 (22%)
mapre1aNP_956158.2 CH 16..114 CDD:278723 56/97 (58%)
EB1 217..254 CDD:281288 8/38 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594768
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.