DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and dnmt3ba

DIOPT Version :10

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_005167049.1 Gene:dnmt3ba / 321084 ZFINID:ZDB-GENE-050314-4 Length:1500 Species:Danio rerio


Alignment Length:158 Identity:54/158 - (34%)
Similarity:92/158 - (58%) Gaps:23/158 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVNAE------NMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTAK 69
            |:|:.|      ..||:::|.|:|..:..:|.::|:..|||.:||:::::||..||||:||..::
Zfish     3 TNVSLEPNNPDDKCSRYEVLGWINETLQTNFTQVEQCRSGACFCQLIDLLFPGTINLKKVKFESQ 67

  Fly    70 LEHEYLHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLENIKS--LA 132
            ...:::.|..|.|.||..|::.:.||::.|:.|:|:.||.:|:||||||      ..|:|.  :.
Zfish    68 KRSDFMQNYGLLQAAFRDLEVTEPVPVNELLSGKFRPNFTYLKWFKKFF------YANVKQERVY 126

  Fly   133 NAPLAKPIKPRQFAKERSPVNANDDALK 160
            ||..|:.      .:|..||   ||.:|
Zfish   127 NAFEARD------GQEIVPV---DDVMK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 BIM1 19..>124 CDD:227542 40/104 (38%)
EB1 184..216 CDD:460870
dnmt3baXP_005167049.1 BIM1 17..>174 CDD:227542 51/144 (35%)
PWWP 904..1014 CDD:470613
FYVE_like_SF 1078..1197 CDD:333710
Dcm 1219..1497 CDD:440040
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.