DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and CG15306

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster


Alignment Length:244 Identity:67/244 - (27%)
Similarity:107/244 - (43%) Gaps:60/244 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VALTSVNAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTAKLEH 72
            |.:|..:....||.|:|.|.|..:..:...||:||:|||||.:|.|::|..|||||||..:..|:
  Fly     9 VTVTHNSLVQWSRGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQEY 73

  Fly    73 EYLHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLENIKSLANAPLA 137
            ||::|.:..|:|||::.:.....::.||||...:||:|..||:.||        |:         
  Fly    74 EYVNNFKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFF--------NV--------- 121

  Fly   138 KPIKPRQFAKERSPVNANDDALKELIDEMKNLSLKREDIMEASNQIYNKLRLVEDLVNDMINNNQ 202
                  ...|::.   |..|||         ::...::|...|:::..|.|.             
  Fly   122 ------NHTKDKC---AGYDAL---------VARDHQNIGIGSSKLTTKDRF------------- 155

  Fly   203 LVELCKRIQAVLYKTIDGEINEEPVEVNED------NGDEGAEHADPND 245
                  |:..|....|.|::......:|..      |.||.::|.|..|
  Fly   156 ------RLVKVKTTAIRGKVATCQATINSSLCTGKANQDEDSQHTDKKD 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 33/72 (46%)
EB1 184..216 CDD:281288 4/31 (13%)
CG15306NP_001259403.1 CH 20..103 CDD:278723 35/82 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468768
Domainoid 1 1.000 89 1.000 Domainoid score I2088
eggNOG 1 0.900 - - E1_COG5217
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100079at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.