DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and Mst27D

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001285705.1 Gene:Mst27D / 319019 FlyBaseID:FBgn0051907 Length:424 Species:Drosophila melanogaster


Alignment Length:276 Identity:60/276 - (21%)
Similarity:111/276 - (40%) Gaps:52/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTSVNAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTAKLEHEY 74
            :|:...:.:|...:|.::|:.:....:..|:|.:||.|||:|..:|||.|.:.:||.......::
  Fly    19 VTASKYDVVSVKTLLMFINSKLDCELRGFEDLKTGAVYCQLMHRLFPNSIQIHKVKFYTNDISDF 83

  Fly    75 LHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQ--------------AP-G 124
            ..|.||....|.:|::...:|:..|..|..|  ..|..|..||:::.              :| |
  Fly    84 QLNFRLLNNCFQKLRVTVYMPVHELTLGHNQ--VVFCNWIYKFYEANDKGNEYDARKVRKGSPIG 146

  Fly   125 LENIKSLANAPLAKPI--------------KPRQFAKERSPVNANDDALKELIDEMKNLSLKRED 175
            |:|...:|:.......              ||.:|.::.|.     |||.......|  |::||.
  Fly   147 LDNSYKVASISTGSTCSVHKCQSMVFNYAKKPVRFERQNSL-----DALSFRPGIFK--SIRREK 204

  Fly   176 IMEASNQIYNKLRLVE------------DLVNDMINNNQLVELCKRIQAVLYKTIDGEINEEPVE 228
            ..|.:|....:.:.::            .|.:|..:..:|....:.:|....|.::...|:|  :
  Fly   205 PTEQANPEPQQTKNIKKSSQFLAESKHVSLPSDSEDELELKAQKRYLQDQFVKKLNSSKNDE--K 267

  Fly   229 VNEDNGDEGAEHADPN 244
            ...|...:.:|...||
  Fly   268 TGTDATSKISEIPRPN 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 22/72 (31%)
EB1 184..216 CDD:281288 4/43 (9%)
Mst27DNP_001285705.1 CH 30..124 CDD:278723 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468767
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.