DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and CG32371

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_729295.1 Gene:CG32371 / 317999 FlyBaseID:FBgn0052371 Length:294 Species:Drosophila melanogaster


Alignment Length:180 Identity:77/180 - (42%)
Similarity:107/180 - (59%) Gaps:4/180 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTVALTSVNAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTAKL 70
            :.|..|:..:.|.||.:||.||||.:...|.|:||||:||||||:|:::|...|.::|||....:
  Fly    10 VNVRYTNKLSSNSSRAEMLSWVNNTLKSQFFKVEELCTGAAYCQLMDILFARSIPMQRVKFRTNV 74

  Fly    71 EHEYLHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLENIKSLA-NA 134
            |:||:.|.:|.|..||:..:||.:|||||:|||:||||||||||:||||:.....|....:| |.
  Fly    75 EYEYIQNFKLLQGCFNKFVVDKIIPIDRLVKGRYQDNFEFLQWFRKFFDANYESREYDPVIARNG 139

  Fly   135 PLAKPIKPRQFAKERSPVNANDDALKELIDEMKNLSLKREDIMEASNQIY 184
            .:.....|...||.|..||.::...|.  .|..:....|. ..|..||:|
  Fly   140 AMLGLGSPPMEAKLRKSVNKSNPQTKP--TEESSAQTDRA-TTEPKNQVY 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 34/72 (47%)
EB1 184..216 CDD:281288 1/1 (100%)
CG32371NP_729295.1 CH 22..121 CDD:278723 54/98 (55%)
BIM1 23..>269 CDD:227542 74/167 (44%)
EB1 255..293 CDD:281288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468771
Domainoid 1 1.000 103 1.000 Domainoid score I2253
eggNOG 1 0.900 - - E1_COG5217
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100079at50557
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 1 1.000 - - mtm1038
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
98.850

Return to query results.
Submit another query.