DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and MAPRE3

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001289979.1 Gene:MAPRE3 / 22924 HGNCID:6892 Length:281 Species:Homo sapiens


Alignment Length:283 Identity:98/283 - (34%)
Similarity:151/283 - (53%) Gaps:48/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKLTVALTSVNAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTA 68
            :.:.|..|||.:||:||||||.|||:.:|.::.|||:|||||||||.|:|:||.|::|::||..|
Human     1 MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQA 65

  Fly    69 KLEHEYLHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLENIKSLAN 133
            ||||||:||.::.|.||.::.:||.:|:::|:||:|||||||:||||||||:...|.:....||.
Human    66 KLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLAR 130

  Fly   134 -----APLAKP------------------------------------IKPRQFAKERSPVNAN-- 155
                 ||...|                                    :.|....::..|...|  
Human   131 QGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGG 195

  Fly   156 ---DDALKELIDEMKNLSLKREDIMEASNQIYNKLRLVEDLVNDMINNNQLVELCKRIQAVLYKT 217
               |..:.||..::.:|.|..:.:.:..:..::|||.:|.:..:..:.|..|  ...|..:||.|
Human   196 HETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPV--ISGIIGILYAT 258

  Fly   218 IDGEINEEPVEVNEDNGDEGAEH 240
            .:|....|..|:.|...::..|:
Human   259 EEGFAPPEDDEIEEHQQEDQDEY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 42/72 (58%)
EB1 184..216 CDD:281288 8/31 (26%)
MAPRE3NP_001289979.1 BIM1 16..279 CDD:227542 91/264 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..181 0/23 (0%)
DCTN1-binding 217..281 14/65 (22%)
APC-binding 217..260 10/44 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..281 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158820
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.