Sequence 1: | NP_611384.2 | Gene: | CG18190 / 37179 | FlyBaseID: | FBgn0034403 | Length: | 248 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036457.1 | Gene: | MAPRE1 / 22919 | HGNCID: | 6890 | Length: | 268 | Species: | Homo sapiens |
Alignment Length: | 269 | Identity: | 100/269 - (37%) |
---|---|---|---|
Similarity: | 146/269 - (54%) | Gaps: | 42/269 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LKLTVALTSVNAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTA 68
Fly 69 KLEHEYLHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLEN------ 127
Fly 128 -------IKSLANAPLAKPIKP---------RQFAKERSP---------------VNANDDALKE 161
Fly 162 LIDEMKNLSLKREDIMEASNQIYNKLRLVEDLVNDMINNNQLVELCKRIQAVLYKTIDGEINEE- 225
Fly 226 --PVEVNED 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18190 | NP_611384.2 | CH | 19..>92 | CDD:278723 | 40/72 (56%) |
EB1 | 184..216 | CDD:281288 | 8/31 (26%) | ||
MAPRE1 | NP_036457.1 | BIM1 | 16..257 | CDD:227542 | 92/242 (38%) |
Interaction with MTUS2/TIP150. /evidence=ECO:0000269|PubMed:19543227 | 124..268 | 32/146 (22%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 146..187 | 7/40 (18%) | |||
Interaction with CDK5RAP2. /evidence=ECO:0000269|PubMed:19553473 | 185..268 | 23/85 (27%) | |||
DCTN1-binding | 208..268 | 16/62 (26%) | |||
APC-binding | 220..242 | 5/23 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165158821 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5217 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1237523at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000490 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10623 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X303 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.810 |