DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and MAPRE1

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_036457.1 Gene:MAPRE1 / 22919 HGNCID:6890 Length:268 Species:Homo sapiens


Alignment Length:269 Identity:100/269 - (37%)
Similarity:146/269 - (54%) Gaps:42/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKLTVALTSVNAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTA 68
            :.:.|..|||.::|:||||||.|:|..:..:..|||:|||||||||.|:|:||..|.||:||..|
Human     1 MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQA 65

  Fly    69 KLEHEYLHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLEN------ 127
            ||||||:.|.::.|..|.|:.:||.:|:|:|:||:|||||||:||||||||:...|.:.      
Human    66 KLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAAR 130

  Fly   128 -------IKSLANAPLAKPIKP---------RQFAKERSP---------------VNANDDALKE 161
                   ..||....|.||.||         |..:.:|:.               |...||...|
Human   131 QGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAE 195

  Fly   162 LIDEMKNLSLKREDIMEASNQIYNKLRLVEDLVNDMINNNQLVELCKRIQAVLYKTIDGEINEE- 225
            |:.::..|.|..||:.:..:..:.|||.:|.:..:  |..:...:.:||..:||.|.:|.:..: 
Human   196 LMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQE--NEGENDPVLQRIVDILYATDEGFVIPDE 258

  Fly   226 --PVEVNED 232
              |.|..|:
Human   259 GGPQEEQEE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 40/72 (56%)
EB1 184..216 CDD:281288 8/31 (26%)
MAPRE1NP_036457.1 BIM1 16..257 CDD:227542 92/242 (38%)
Interaction with MTUS2/TIP150. /evidence=ECO:0000269|PubMed:19543227 124..268 32/146 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..187 7/40 (18%)
Interaction with CDK5RAP2. /evidence=ECO:0000269|PubMed:19553473 185..268 23/85 (27%)
DCTN1-binding 208..268 16/62 (26%)
APC-binding 220..242 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158821
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.