DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and ebp-2

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_496438.1 Gene:ebp-2 / 174744 WormBaseID:WBGene00012156 Length:299 Species:Caenorhabditis elegans


Alignment Length:296 Identity:84/296 - (28%)
Similarity:136/296 - (45%) Gaps:68/296 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTVALTSVNAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTAKL 70
            :.|.:::|..:.:||.:.:.||||::..||.|:||:.|||||||:..::| |.||||:||...:.
 Worm     3 VNVFISAVTTDTLSRKEAVAWVNNLLKSHFTKVEEMASGAAYCQLTHLLF-NAINLKKVKFNPRS 66

  Fly    71 EHEYLHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKF------------------ 117
            |.:.|:|.::....:..|.:||.|.::::.|.:||||.||||||.||                  
 Worm    67 EPDVLNNWKVLTTTWKDLGIDKPVDVEKMKKAKFQDNMEFLQWFYKFYNANLTTEPEEYDAVGAR 131

  Fly   118 FDSQAPGLENIKSLANAPLAKPI--------KPRQFA---------------------------- 146
            |....|.|:.  |..:.|:|.|.        |||..|                            
 Worm   132 FGEDLPALKG--STGSRPVAAPARPVAAAPPKPRPAAPAVAAPAVKASVPPTVRNGTRPAPATSA 194

  Fly   147 -KERSPVNANDDALKELIDEMKNLSLKREDI---MEASNQ-IYNKLRLVEDLVNDMINNNQLVEL 206
             ..|:..:|:::.||:.|::.|..|.:.|..   ||...: .|:.|:.||.|.|:...:......
 Worm   195 GTRRADPSASEELLKQEIEKHKAASDEWETTAKEMETEREYYYSILQRVESLANEAEESGSSTVD 259

  Fly   207 CKRIQAVLY------KTIDGEINEEPVEVNEDNGDE 236
            ...::.:||      :.:|...||..||..:.|.|:
 Worm   260 VAALKTILYAGNEDTEQVDEIENEHLVESLQANLDD 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 30/72 (42%)
EB1 184..216 CDD:281288 8/37 (22%)
ebp-2NP_496438.1 CH 16..113 CDD:278723 44/97 (45%)
EB1 230..269 CDD:281288 8/38 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166342
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.