DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and Mapre1

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_031922.1 Gene:Mapre1 / 13589 MGIID:891995 Length:268 Species:Mus musculus


Alignment Length:269 Identity:103/269 - (38%)
Similarity:148/269 - (55%) Gaps:42/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKLTVALTSVNAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTA 68
            :.:.|..|||.::|:||||||.|:|..:..:..|||:|||||||||.|:|:||..|.||:||..|
Mouse     1 MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQA 65

  Fly    69 KLEHEYLHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLEN------ 127
            ||||||:.|.::.|..|.|:.:||.:|:|:|:||:|||||||:||||||||:...|.|.      
Mouse    66 KLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPVAAR 130

  Fly   128 -------IKSLANAPLAKPIKP---------RQFAKERSP---------------VNANDDALKE 161
                   ..||....|:||.||         |..|.:|:.               |...||...|
Mouse   131 QGQETAVAPSLVAPALSKPKKPLGSSTAAPQRPIATQRTTAAPKAGPGMVRKNPGVGNGDDEAAE 195

  Fly   162 LIDEMKNLSLKREDIMEASNQIYNKLRLVEDLVNDMINNNQLVELCKRIQAVLYKTIDGEINEE- 225
            |:.::|.|.|..||:.:..:..:.|||.:|.:..:  |..:...:.:||..:||.|.:|.:..: 
Mouse   196 LMQQVKVLKLTVEDLEKERDFYFGKLRNIELICQE--NEGENDPVLQRIVDILYATDEGFVIPDE 258

  Fly   226 --PVEVNED 232
              |.|..|:
Mouse   259 GGPQEEQEE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 40/72 (56%)
EB1 184..216 CDD:281288 8/31 (26%)
Mapre1NP_031922.1 BIM1 16..257 CDD:227542 95/242 (39%)
Interaction with MTUS2/TIP150. /evidence=ECO:0000250 124..268 34/146 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..180 8/33 (24%)
DCTN1-binding. /evidence=ECO:0000250 208..268 16/62 (26%)
APC-binding. /evidence=ECO:0000250 220..242 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849199
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.