DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18190 and Mapre1

DIOPT Version :9

Sequence 1:NP_611384.2 Gene:CG18190 / 37179 FlyBaseID:FBgn0034403 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_612518.2 Gene:Mapre1 / 114764 RGDID:621781 Length:268 Species:Rattus norvegicus


Alignment Length:269 Identity:104/269 - (38%)
Similarity:149/269 - (55%) Gaps:42/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LKLTVALTSVNAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCINLKRVKMTA 68
            :.:.|..|||.::|:||||||.|:|..:..:..|||:|||||||||.|:|:||..|.||:||..|
  Rat     1 MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQA 65

  Fly    69 KLEHEYLHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDSQAPGLEN------ 127
            ||||||:.|.::.|..|.|:.:||.:|:|:|:||:|||||||:||||||||:...|.|.      
  Rat    66 KLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPVAAR 130

  Fly   128 -------IKSLANAPLAKPIKP---------RQFAKER--------------SPVNAN-DDALKE 161
                   ..||....|:||.||         |..|.:|              :|...| ||...|
  Rat   131 QGQETAVAPSLVAPALSKPKKPLGSGSAAPQRPIATQRTTAAPKAGPGMVRKNPGMGNGDDEAAE 195

  Fly   162 LIDEMKNLSLKREDIMEASNQIYNKLRLVEDLVNDMINNNQLVELCKRIQAVLYKTIDGEINEE- 225
            |:.::|.|.|..||:.:..:..:.|||.:|.:..:  |..:...:.:||..:||.|.:|.:..: 
  Rat   196 LMQQVKVLKLTVEDLEKERDFYFGKLRNIELICQE--NEGENDPVLQRIVDILYATDEGFVIPDE 258

  Fly   226 --PVEVNED 232
              |.|..|:
  Rat   259 GGPQEEQEE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18190NP_611384.2 CH 19..>92 CDD:278723 40/72 (56%)
EB1 184..216 CDD:281288 8/31 (26%)
Mapre1NP_612518.2 BIM1 16..257 CDD:227542 96/242 (40%)
Interaction with MTUS2/TIP150. /evidence=ECO:0000250 124..268 35/146 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..191 10/44 (23%)
DCTN1-binding. /evidence=ECO:0000250 208..268 16/62 (26%)
APC-binding. /evidence=ECO:0000250 220..242 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352819
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.