DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15084 and AT2G29430

DIOPT Version :10

Sequence 1:NP_611383.1 Gene:CG15084 / 37178 FlyBaseID:FBgn0034402 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_180504.1 Gene:AT2G29430 / 3768235 AraportID:AT2G29430 Length:84 Species:Arabidopsis thaliana


Alignment Length:70 Identity:20/70 - (28%)
Similarity:37/70 - (52%) Gaps:2/70 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 MPYNIWCDGCKNHIGMGVRYNAEKTKV--GMYYTTPVFKFRMKCHLCDNHFEIQTDPGNLDYVIL 111
            :|..:.|:.|.|.:..|.::.:....|  ..|....:|:|:::|....:..:.:|||.|.|::|.
plant    10 LPMRLQCNNCDNIMSKGTKFTSRVEDVIGETYLGIKIFRFQIQCTNGSHEMKFRTDPKNADFIIE 74

  Fly   112 SGARR 116
            |||.|
plant    75 SGATR 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15084NP_611383.1 Saf4_Yju2 9..311 CDD:461333 20/70 (29%)
AT2G29430NP_180504.1 Saf4_Yju2 10..>79 CDD:461333 19/68 (28%)

Return to query results.
Submit another query.