DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MetRS and ARC1

DIOPT Version :9

Sequence 1:NP_611382.1 Gene:MetRS / 37177 FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_011410.1 Gene:ARC1 / 852773 SGDID:S000003073 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:125 Identity:35/125 - (28%)
Similarity:51/125 - (40%) Gaps:30/125 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   842 LKASTKDKAIWQPEVTKLLDLKKQLEEAKKKT-ATAAAPAATPAPSNGSQSVQDLEKAIQEQGDK 905
            |:.|:.||.    |:...|||..::.|.|||. |..||.||..|.       :|:.|        
Yeast   109 LEVSSTDKL----EI
NHDLDLPHEVIEKKKKAPAGGAADAAAKAD-------EDVSK-------- 154

  Fly   906 VRKLKGSTKDKTVWQPEVNILLDLKKQLEAVQKAAKAAPA------ANAAPAASPAATAD 959
                |...:|....:|:...|..|:::.:|.:.|.|||.|      .|.||.....:..|
Yeast   155 ----KAKKQDHPRGKPDEETLKKLREEAKAKKAAKKAANAKQQQEQQNKAPEKPKPSAID 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029
MetRS_core 255..625 CDD:173907
Anticodon_Ia_Met 634..763 CDD:153411
MetRS_RNA 828..868 CDD:238475 8/25 (32%)
MetRS_RNA 895..938 CDD:238475 7/42 (17%)
MetRS_RNA 966..1009 CDD:238475
ARC1NP_011410.1 GST_C_Arc1p_N_like 22..119 CDD:198337 4/13 (31%)
PLN02610 <193..376 CDD:215329 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.