Sequence 1: | NP_611382.1 | Gene: | MetRS / 37177 | FlyBaseID: | FBgn0034401 | Length: | 1022 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021325469.1 | Gene: | aimp1b / 494049 | ZFINID: | ZDB-GENE-041212-13 | Length: | 346 | Species: | Danio rerio |
Alignment Length: | 210 | Identity: | 45/210 - (21%) |
---|---|---|---|
Similarity: | 76/210 - (36%) | Gaps: | 46/210 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 847 KDKAIWQPEV---TKLL-----------DLKKQLEEAKKKTAT--------AAAPAAT------P 883
Fly 884 APS-NGSQSVQDLEKAIQEQGDKVRKLKG-STKDKTVWQPEVNI-----------LLDLKKQLEA 935
Fly 936 VQKAAKAAPAANAAPAASPAATADAAKVKALEDKIAQQAEKVRTLKATGDAAVWKPEVDILLSLK 1000
Fly 1001 NELAALTGTPVAGGQ 1015 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MetRS | NP_611382.1 | GstA | 1..175 | CDD:223698 | |
GST_N_family | 1..65 | CDD:238319 | |||
GST_C_family | 63..164 | CDD:295467 | |||
PRK12268 | 254..812 | CDD:237029 | |||
MetRS_core | 255..625 | CDD:173907 | |||
Anticodon_Ia_Met | 634..763 | CDD:153411 | |||
MetRS_RNA | 828..868 | CDD:238475 | 12/34 (35%) | ||
MetRS_RNA | 895..938 | CDD:238475 | 9/54 (17%) | ||
MetRS_RNA | 966..1009 | CDD:238475 | 8/42 (19%) | ||
aimp1b | XP_021325469.1 | PRK12267 | <179..346 | CDD:330948 | 18/107 (17%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0143 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |