DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MetRS and MetRS-m

DIOPT Version :9

Sequence 1:NP_611382.1 Gene:MetRS / 37177 FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_001262564.1 Gene:MetRS-m / 41733 FlyBaseID:FBgn0027083 Length:582 Species:Drosophila melanogaster


Alignment Length:621 Identity:146/621 - (23%)
Similarity:236/621 - (38%) Gaps:127/621 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 ITSALPYVNNVPHLGNIIGCVLSADIYARYS--RSAGYNTLLICGTDEYGTATENKALAENLTPR 320
            :|:.:.|||..||:|::...|: ||.:.||.  |....:..|..||||:||..:..|....:...
  Fly    22 VTTPIFYVNAAPHIGHLYSAVI-ADAHCRYQRLRYPEQDVRLCTGTDEHGTKIQQAASLHGVPVA 85

  Fly   321 EICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLKAGYIITESVEQLLCQKCDRF 385
            :.||...:.:..::|...|..|.|.|||.......|...::.:...|:|.:.:.....|...:.|
  Fly    86 KYCDDISQRYREVFRSASIQQDDFIRTTEDRHKRAVANFWRTLHTRGHIYSAAYSGWYCVSDETF 150

  Fly   386 LADRFVEGTCPHPGCGYEDARGDQCD-KCGKLVNATELIRPRCKVCNSAPVLRSSDQLFIDLPKA 449
            |.|..:.         .::|.|.:.. :.|..|..||                .::.:| .|.:.
  Fly   151 LTDSQLR---------LDEATGTRYSLESGHPVEWTE----------------ETNYMF-RLSQF 189

  Fly   450 EPQLKEWVDKSEGGWTHNAKV-------ITRAWLKEGLKPRCITRD---LKWGIPVPHEGFEKKV 504
            :..::.|| |:|      |:|       |....|.|.|....::|.   :.|.||||.:  :.:.
  Fly   190 QDDVRHWV-KTE------ARVRPAKFEKILLDTLSEPLPDVSVSRPSNRVHWAIPVPDD--DSQT 245

  Fly   505 FYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVELFQFMAKDNVPFHSVVWPSVLLAINKGHTL 569
            .|||.||...|:|......:::...|.||:       |.:.||.:.||.:.|.:.|||  .|...
  Fly   246 VYVWLDALVNYLSSVGYPDEKFSAHWPPAQ-------QVIGKDILKFHGIYWTAFLLA--AGLEP 301

  Fly   570 VSHIMATEYLNYEDGKFSKSRGIGVFGNDAQE----TGIPADVWRFYLASARPEGQDSSFSWNDL 630
            ...:....:...:..|.|||:...|....|.:    .|:     |::|........|.::|....
  Fly   302 PGQLYVHSHWTVDGQKMSKSKHNVVDPLQAAQQYTMEGL-----RYFLLREGVAHSDGNYSHVKA 361

  Fly   631 AARNNSELLNNLGNFVNRALVFCEKNFSSTVPGVITTQDELVLLALINRELRGYINSMEKAK-LR 694
            ....||||.:.|||.::||      :..|..||.|......       ..|...:.|::.|| |:
  Fly   362 QRILNSELADTLGNLLSRA------SAKSLNPGQIYPSPSA-------EHLADLLRSLDVAKRLQ 413

  Fly   695 DGVRHL--------------------LAISRHGNGYMQSQQPWVLLKGT-DDQKTRASTIIGLCV 738
            |.:..|                    :|.....|.:.:|.:||.|..|. |..:.|..|||.:.:
  Fly   414 DSLLQLSERCESHYECNHFHLVADTTMAALHAANNFFESSKPWTLKAGAPDGNQARLETIIAMTM 478

  Fly   739 NIACLLANLLFPYMPTTARTLFGQLNAK-------------QTPLNAEKPLVTLLLPAGHQIGKP 790
            :...|...:|.|.:|..|..|..:|:..             .|..|:...      |||  :|:.
  Fly   479 DALRLSGIVLQPIIPQLANRLLDKLSVPTAQRGWNYLAESFATSPNSSNS------PAG--LGES 535

  Fly   791 APL----FAKLEQSFIDELKGKYGGAQATNDAAHSQ 822
            ..|    .|.|.|..::|...|....|....|..|:
  Fly   536 RQLDGQTSALLFQRILEETSAKEVKEQKPQPAKRSK 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 143/609 (23%)
MetRS_core 255..625 CDD:173907 91/383 (24%)
Anticodon_Ia_Met 634..763 CDD:153411 38/150 (25%)
MetRS_RNA 828..868 CDD:238475
MetRS_RNA 895..938 CDD:238475
MetRS_RNA 966..1009 CDD:238475
MetRS-mNP_001262564.1 MetRS_core 20..356 CDD:173907 91/383 (24%)
PRK11893 21..553 CDD:237012 141/601 (23%)
Anticodon_Ia_like 365..503 CDD:299868 38/150 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446760
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.