DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MetRS and TyrRS

DIOPT Version :9

Sequence 1:NP_611382.1 Gene:MetRS / 37177 FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_648895.1 Gene:TyrRS / 39829 FlyBaseID:FBgn0027080 Length:525 Species:Drosophila melanogaster


Alignment Length:432 Identity:95/432 - (21%)
Similarity:158/432 - (36%) Gaps:131/432 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   666 TTQDELVLLALINRELRGYINS-----------MEKAKLRDGVR-----HLLAISRHGNGYMQSQ 714
            |..|:.:...|..|:|:.|..:           :..:|:.|.::     .:|....|  .|:.:.
  Fly    20 TLGDDKLTKILAERDLKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLH--AYLDNM 82

  Fly   715 Q-PWVLLKGTDDQKTR--ASTIIGLCVNIACLLANLLF----PYMPTTARTL-FGQLNAKQTPLN 771
            : ||.||    :.:|:  ...|..:..:|...|..|.|    .|..:...|| ..:|::..|..:
  Fly    83 KAPWSLL----ELRTKYYEQVIKAMLSSIGVPLEKLKFVKGSDYQLSKEYTLDVYKLSSVVTQHD 143

  Fly   772 AEK-----------PLVTLLLPAGHQIGKPAPLFAKLEQSFIDELKGKYGGAQATNDAAHSQ--I 823
            |:|           ||::.||..|.|         .|::.:: ::..::||.........|:  :
  Fly   144 AKKAGAEVVKQVEYPLLSGLLYPGLQ---------ALDEEYL-KVDAQFGGVDQRKIFTFSEKYL 198

  Fly   824 SAADLEKAVQAQADKV-----RELKASTKDKAIWQPEVTKLLD----LKKQLEEAKKKTATAAAP 879
            .....||.:......|     .::.:|.:|..|      .|||    :||:|::|..:....|  
  Fly   199 PQLGYEKRIHFMNPMVPGLAGGKMSSSEEDSKI------DLLDSPANVKKKLKKAFCEPGNIA-- 255

  Fly   880 AATPAPSNGSQS--------------------------------VQDLEKAIQEQGDKVRKLKGS 912
                  .||..|                                .:||||...|.     ||...
  Fly   256 ------DNGLLSFVKHVLFSLFKEGEGFEVNREAEHGGDVTFLKYEDLEKYYAED-----KLHPG 309

  Fly   913 TKDKTVWQPEVNILLD-LKKQLE--AVQKAAKAA--PAANAAPAASPAATADAAKVKALEDKIAQ 972
            ....|| :..:|.||| ::|..|  .:||.:.||  |.|.....|:|||.||......|:.::.:
  Fly   310 DLKATV-EKYINRLLDPIRKAFENPELQKLSAAAYPPPAKVKAGAAPAAGADEDAPHRLDIRVGK 373

  Fly   973 QAEKVRTLKATGDAAVWKPEVDILLSLKNELA-ALTGTPVAG 1013
            ..|..|           .|:.|.|..||.:|| |...|.::|
  Fly   374 VVEVAR-----------HPDADTLYVLKIDLAEAQPRTIISG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 36/180 (20%)
MetRS_core 255..625 CDD:173907
Anticodon_Ia_Met 634..763 CDD:153411 24/120 (20%)
MetRS_RNA 828..868 CDD:238475 12/48 (25%)
MetRS_RNA 895..938 CDD:238475 14/45 (31%)
MetRS_RNA 966..1009 CDD:238475 11/43 (26%)
TyrRSNP_648895.1 nt_trans 8..334 CDD:294020 70/349 (20%)
tyrS 12..332 CDD:272976 69/347 (20%)
tRNA_bind_EMAP-II_like 364..466 CDD:239198 13/52 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.