Sequence 1: | NP_611382.1 | Gene: | MetRS / 37177 | FlyBaseID: | FBgn0034401 | Length: | 1022 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610426.2 | Gene: | AIMP1 / 35892 | FlyBaseID: | FBgn0033351 | Length: | 323 | Species: | Drosophila melanogaster |
Alignment Length: | 207 | Identity: | 42/207 - (20%) |
---|---|---|---|
Similarity: | 72/207 - (34%) | Gaps: | 70/207 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 788 GKPAPLFAKLEQSFID--ELKGKYGGAQATNDAAHSQISAADLEKAVQAQADKVRELKASTK--D 848
Fly 849 KAIWQPEVTKLLDLKKQL------------------EEAKKKTATAAAPAATPAPSNGSQSVQDL 895
Fly 896 EKAIQEQGDKVRKLKGSTKDKTVWQPEVNILLDLKKQLEAVQKAAKAAPAANAAPAASPAATADA 960
Fly 961 AKVKALEDKIAQ 972 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MetRS | NP_611382.1 | GstA | 1..175 | CDD:223698 | |
GST_N_family | 1..65 | CDD:238319 | |||
GST_C_family | 63..164 | CDD:295467 | |||
PRK12268 | 254..812 | CDD:237029 | 4/25 (16%) | ||
MetRS_core | 255..625 | CDD:173907 | |||
Anticodon_Ia_Met | 634..763 | CDD:153411 | |||
MetRS_RNA | 828..868 | CDD:238475 | 9/59 (15%) | ||
MetRS_RNA | 895..938 | CDD:238475 | 4/42 (10%) | ||
MetRS_RNA | 966..1009 | CDD:238475 | 2/7 (29%) | ||
AIMP1 | NP_610426.2 | tRNA_bind_EMAP-II_like | 161..262 | CDD:239198 | 3/15 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0143 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |