DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15097 and AT1G22040

DIOPT Version :9

Sequence 1:NP_001261079.1 Gene:CG15097 / 37172 FlyBaseID:FBgn0034396 Length:743 Species:Drosophila melanogaster
Sequence 2:NP_173623.1 Gene:AT1G22040 / 838809 AraportID:AT1G22040 Length:475 Species:Arabidopsis thaliana


Alignment Length:496 Identity:106/496 - (21%)
Similarity:168/496 - (33%) Gaps:168/496 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 DDSECKELLLEAMKYHLLPEQRSIM----------GSQRTQERRPEGMKPYVFAVGGGSLFAIHN 337
            |:.||..|:..      ||::.||.          .|.|...||      :..||....::::..
plant    36 DEEECCRLIPS------LPDELSIQILARLPRICYSSVRLVSRR------WRSAVSTSEVYSLRK 88

  Fly   338 ECEVYNPRSNSWSPVAPMLWRRSRSGVTSLHKQLYVVGGYDGVSD-----------LATAESYNP 391
            |.    .|:..|..|           :|..|:...:....|.||.           :...||...
plant    89 EL----GRTEEWLYV-----------LTKGHEDKLLWYALDPVSTKWQRLPPMPVVVYEEESRKS 138

  Fly   392 LTNKWSNITPM----GTKRSCLG--------------ICSYDALIYVCGGYDGASCLSSMERYDP 438
            |:..|:.|||.    ...||.||              |.:.|..:||.||...:..:|.:.|:||
plant   139 LSGLWNMITPSFNVGAIVRSFLGRRDSSEQMPFCGCAIGAVDGGLYVIGGLSRSKTVSCVWRFDP 203

  Fly   439 LTGIWSSCPAMSTRRRYCRLAVLENCIYSLGGFD----STNYQSSVERFDPRVGRWQPVPSMSAR 499
            :...||...:|...|.|.:..||...:|.:||.|    ..:...|.|.:||....|..||||...
plant   204 ILNSWSEVSSMLASRAYSKTGVLNKKLYVVGGVDRGRGGLSPLQSAEVYDPSTDAWSEVPSMPFS 268

  Fly   500 RS---------------SCGVASTDGHLYCIGGNDGTMCMS------------SGERFSLRRNSW 537
            ::               :.|:...:|.|          |:.            .||.:....|.|
plant   269 KAQVLPNAFLADLLKPIATGMTCYNGRL----------CVPQSLYSWPFFVDVGGEVYDPETNLW 323

  Fly   538 -EPIAAMHS-----RRSTHEVVEVEGALFALGGNDGSSSLNS--VERYDTRLNKWSVVNAMVARR 594
             |..:.|..     :..|...|.|:|.|:|.   |.|||:.:  ::.||.:.:.|.||...|   
plant   324 VEMPSGMGEGWPARQAGTKLSVVVDGELYAF---DPSSSMENGKIKVYDQKEDTWKVVIGEV--- 382

  Fly   595 SSVGAAVLECFHLERGLVQTTNLXPLASITESFAAAAASG----------TSNGNSTINGIGSGG 649
                                    |:..:|:|.:....:|          ..|.|.|:.......
plant   383 ------------------------PVYDLTDSESPYLLAGFHGKLHFITRDPNHNVTVLRADVPN 423

  Fly   650 V-IPSSSGVGGTLTVPSRAEAAAFTANIALSSSAPSASSTL 689
            : :.|||....::::|.            |.::||:.|.|:
plant   424 IPVSSSSSSSSSVSIPH------------LKTNAPNKSDTV 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15097NP_001261079.1 BTB 63..166 CDD:279045
PHA03098 65..539 CDD:222983 72/326 (22%)
BACK 174..276 CDD:285009
Kelch 324..369 CDD:128874 7/44 (16%)
KELCH repeat 359..402 CDD:276965 11/53 (21%)
Kelch 370..415 CDD:128874 15/73 (21%)
KELCH repeat 406..450 CDD:276965 16/57 (28%)
Kelch 417..463 CDD:128874 15/45 (33%)
KELCH repeat 453..496 CDD:276965 15/46 (33%)
Kelch 464..510 CDD:128874 14/64 (22%)
Kelch_1 499..543 CDD:279660 9/71 (13%)
KELCH repeat 500..545 CDD:276965 10/72 (14%)
KELCH repeat 547..590 CDD:276965 15/44 (34%)
Kelch 559..603 CDD:128874 12/45 (27%)
AT1G22040NP_173623.1 F-box 44..86 CDD:395521 10/53 (19%)
Kelch_1 170..214 CDD:396078 12/43 (28%)
KELCH repeat 172..214 CDD:276965 12/41 (29%)
PHA03098 <173..385 CDD:222983 57/251 (23%)
KELCH repeat 218..266 CDD:276965 16/47 (34%)
KELCH repeat 269..328 CDD:276965 9/68 (13%)
KELCH repeat 336..378 CDD:276965 13/44 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2576
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.