DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15097 and AT4G39290

DIOPT Version :10

Sequence 1:NP_001261079.1 Gene:CG15097 / 37172 FlyBaseID:FBgn0034396 Length:743 Species:Drosophila melanogaster
Sequence 2:NP_195640.1 Gene:AT4G39290 / 830085 AraportID:AT4G39290 Length:365 Species:Arabidopsis thaliana


Alignment Length:235 Identity:55/235 - (23%)
Similarity:90/235 - (38%) Gaps:54/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 GICSYDALIYVCGGYD-GASCLSSMERYDPLTGIWSSCPAMSTRR-RYCRLAVLENCIYSLGG-- 470
            |:.:..:.||..||.: ..|..|.:...|..:..|...|:|...| .:....||...||.:||  
plant   111 GVVAVGSDIYAIGGRNLNNSASSKVMVMDCRSHTWREAPSMRVARDDFPSTCVLNGKIYVIGGCK 175

  Fly   471 -FDSTNYQSSVERFDPRVGRWQ--PVPSMSARRSSCGVASTDGHLYCIGGNDGTMCMSSGER--- 529
             .||||:   :|.||.:...|:  .:|:....|         |..|.|.|....:.:||.|.   
plant   176 NLDSTNW---IEVFDTKTQTWEFLQIPNEEVCR---------GFNYKIVGYKEAIHVSSLENNRA 228

  Fly   530 ----FSLRRNSW-EP-IAAMHSRRSTHEVVEVEGALFALGGNDGSSSLNSVERYDTRLNKWSVVN 588
                :.:.:..| || ::..|....::.|  :|...:..       |...::.||:....|..:.
plant   229 TFMTYEIHKGRWRE
PHLSLSHGFHFSNCV--IENVFYRY-------SYEMLQWYDSCRKIWKNLK 284

  Fly   589 AMVARRSSV-------------GAAVL---ECFHLERGLV 612
            ..| |||.:             |..||   ||..:::.|:
plant   285 GFV-RRSIMNPRGEGVKMVNYGGNIVLLWEECVTIKKKLI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15097NP_001261079.1 BTB_POZ 51..171 CDD:453885
PHA03098 65..539 CDD:222983 36/143 (25%)
BACK 169..282 CDD:475122
KELCH repeat 359..402 CDD:276965
KELCH repeat 406..450 CDD:276965 10/40 (25%)
KELCH repeat 453..496 CDD:276965 16/48 (33%)
KELCH repeat 500..545 CDD:276965 11/53 (21%)
KELCH repeat 547..590 CDD:276965 6/42 (14%)
Kelch 559..603 CDD:128874 11/59 (19%)
AT4G39290NP_195640.1 F-box_AtAFR-like 13..56 CDD:438923
NanM 98..>242 CDD:442289 36/142 (25%)
KELCH repeat 108..151 CDD:276965 10/39 (26%)
KELCH repeat 155..196 CDD:276965 15/43 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.