DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15097 and AFR

DIOPT Version :9

Sequence 1:NP_001261079.1 Gene:CG15097 / 37172 FlyBaseID:FBgn0034396 Length:743 Species:Drosophila melanogaster
Sequence 2:NP_565572.1 Gene:AFR / 816990 AraportID:AT2G24540 Length:372 Species:Arabidopsis thaliana


Alignment Length:239 Identity:56/239 - (23%)
Similarity:88/239 - (36%) Gaps:64/239 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 RELISNSQLNISSEER-VFA-----AVINWVKHDLPTRRLHIAELMSNVRLPLVSRDFLMSCVET 277
            |.|.|...|:|||... |||     |.|.|...||.:.|..:...|.| ....:|....:||.. 
plant    67 RFLFSKQSLSISSPYLFVFAFNKSTARIQWQSLDLASGRWFVLPPMPN-SFTKISSPHALSCAS- 129

  Fly   278 ETLMRDDSECKELLLEAMKYHLLPEQRSIMGSQRTQERRPEGMKPYVFAVGGGSLFAIHNECEVY 342
                                  :|.|..:                  |.:|||.   ::....||
plant   130 ----------------------MPRQGKL------------------FVLGGGD---VNRSAVVY 151

  Fly   343 NPRSNSWSPVAPMLWRRSRSGVTSLHKQLYVVGGYDGVSDLAT--AESYNPLTNKWSNITPMGTK 405
            ...:|.||.::||:..|:.....:::.::..|||..|.:..||  .|||:|..:.|:.:     |
plant   152 TALTNRWSCISPMMSPRTYFVSGNVNGKIMAVGGSVGGNGEATTEVESYDPDNDTWTVV-----K 211

  Fly   406 RSCLGICSYDALIY-----VCGGYDGASCLSSM-ERYDPLTGIW 443
            :..:.:..||:.:.     |..|:........| :.||...|.|
plant   212 KLPMVLAKYDSAVIGKEMCVTEGWAWPFMFPPMGQVYDSDEGTW 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15097NP_001261079.1 BTB 63..166 CDD:279045
PHA03098 65..539 CDD:222983 56/239 (23%)
BACK 174..276 CDD:285009 21/62 (34%)
Kelch 324..369 CDD:128874 12/44 (27%)
KELCH repeat 359..402 CDD:276965 12/44 (27%)
Kelch 370..415 CDD:128874 12/46 (26%)
KELCH repeat 406..450 CDD:276965 9/44 (20%)
Kelch 417..463 CDD:128874 7/33 (21%)
KELCH repeat 453..496 CDD:276965
Kelch 464..510 CDD:128874
Kelch_1 499..543 CDD:279660
KELCH repeat 500..545 CDD:276965
KELCH repeat 547..590 CDD:276965
Kelch 559..603 CDD:128874
AFRNP_565572.1 F-box 27..72 CDD:279040 2/4 (50%)
Kelch_1 167..214 CDD:279660 13/51 (25%)
KELCH repeat 168..214 CDD:276965 13/50 (26%)
KELCH repeat 217..259 CDD:276965 9/39 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2576
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.