DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15097 and BTBD18

DIOPT Version :9

Sequence 1:	NP_001261079.1	Gene:	CG15097 / 37172	FlyBaseID:	FBgn0034396	Length:	743	Species:	Drosophila melanogaster
Sequence 2:	NP_001138573.1	Gene:	BTBD18 / 643376	HGNCID:	37214	Length:	712	Species:	Homo sapiens

Alignment Length:	116	Identity:	33/116 - (28%)
Similarity:	64/116 - (55%)	Gaps:	11/116 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    45 PQAHHQNPGHCIASFAAINQMRNNAQLCDVRLEVGGDTINAHRVVLASVSPYFYAMFNDDMLER- 108
            |:..::||.....:|..::..:.:...|||.|:..|:.:.||..:|::.||:|     .:.|||
Human     7 PKILYRNPRFLRLAFLQLHHQQQSDVFCDVLLQAEGEAVPAHCCILSACSPFF-----TERLERE 66

  Fly   109 --TQG---LVRLHDVDSSALRQLIDYTYTGEITITEQNVQVLLPASGLLQM 154
              .||   ::.|..:..|.||:|:|:.||.|:.::::..|.:|.|:..|::
Human    67 RPAQGGKVVLELGGLKISTLRKLVDFLYTSEMEVSQEEAQDVLSAARQLRV 117

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15097	NP_001261079.1	BTB	63..166	CDD:279045	29/98 (30%)
		PHA03098	65..539	CDD:222983	29/96 (30%)
		BACK	174..276	CDD:285009
		Kelch	324..369	CDD:128874
		KELCH repeat	359..402	CDD:276965
		Kelch	370..415	CDD:128874
		KELCH repeat	406..450	CDD:276965
		Kelch	417..463	CDD:128874
		KELCH repeat	453..496	CDD:276965
		Kelch	464..510	CDD:128874
		Kelch_1	499..543	CDD:279660
		KELCH repeat	500..545	CDD:276965
		KELCH repeat	547..590	CDD:276965
		Kelch	559..603	CDD:128874
BTBD18	NP_001138573.1	BTB	24..120	CDD:306997	29/99 (29%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	157..176
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	212..355
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	374..410
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	653..676
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	691..712
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4441
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.810