DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15097 and klhl20

DIOPT Version :9

Sequence 1:NP_001261079.1 Gene:CG15097 / 37172 FlyBaseID:FBgn0034396 Length:743 Species:Drosophila melanogaster
Sequence 2:NP_001135481.1 Gene:klhl20 / 100216018 XenbaseID:XB-GENE-960635 Length:234 Species:Xenopus tropicalis


Alignment Length:223 Identity:90/223 - (40%)
Similarity:128/223 - (57%) Gaps:10/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNHSGEASGNNEDVTTTSNNSTQTPSDLSPPGPNEEVLPQAHHQNPGHCIASFAAINQMRNNAQL 71
            |...||..     :..||..:...|:.|....|....:|....::|..   :...||.:|.:.:|
 Frog    11 STRPGETG-----MDVTSRCTLGDPNKLPEGVPQPARMPYVSDKHPRQ---TLEVINLLRKHREL 67

  Fly    72 CDVRLEVGGDTINAHRVVLASVSPYFYAMFNDDMLERTQGLVRLHDVDSSALRQLIDYTYTGEIT 136
            |||.|.||...|.||||:|::.||||.|||..::.|..|..|.:.|:|..|:..|||::||.:||
 Frog    68 CDVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFSYTSQIT 132

  Fly   137 ITEQNVQVLLPASGLLQMHSVRDACCKFLLRQLHPSNCLGIRSFADAHSCKELHTRSHKYALQNF 201
            :.|.|||.||||:.|||:..:::|||:||.|||.||||||||:|||.|||:||...:.|:...||
 Frog   133 VEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNF 197

  Fly   202 QQVVGTEEFLLLPFEEVRELISNSQLNI 229
            |:|  .:..|.........|::|:|..:
 Frog   198 QEV--RDSVLFRKLNSAYVLVANTQYGV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15097NP_001261079.1 BTB 63..166 CDD:279045 50/102 (49%)
PHA03098 65..539 CDD:222983 78/165 (47%)
BACK 174..276 CDD:285009 22/56 (39%)
Kelch 324..369 CDD:128874
KELCH repeat 359..402 CDD:276965
Kelch 370..415 CDD:128874
KELCH repeat 406..450 CDD:276965
Kelch 417..463 CDD:128874
KELCH repeat 453..496 CDD:276965
Kelch 464..510 CDD:128874
Kelch_1 499..543 CDD:279660
KELCH repeat 500..545 CDD:276965
KELCH repeat 547..590 CDD:276965
Kelch 559..603 CDD:128874
klhl20NP_001135481.1 BTB 59..162 CDD:279045 50/102 (49%)
BTB 69..165 CDD:197585 48/95 (51%)
BACK_Kelch 165..>203 CDD:269808 22/39 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312716at33208
OrthoFinder 1 1.000 - - FOG0000036
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.