DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15096 and YOL163W

DIOPT Version :9

Sequence 1:NP_611376.1 Gene:CG15096 / 37170 FlyBaseID:FBgn0034394 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_014479.1 Gene:YOL163W / 854001 SGDID:S000005523 Length:169 Species:Saccharomyces cerevisiae


Alignment Length:101 Identity:22/101 - (21%)
Similarity:35/101 - (34%) Gaps:32/101 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 YNWSEKTKSLLLSSFFW-----GYVITQVPAGQLARKYGGKVMILSGLAICSILNILTPICAKIG 136
            |.:|....|:.| ||||     ..:||.:.|..:....|     :.|:|                
Yeast    44 YFYSSSELSIRL-SFFWVTLSLTQIITSIVAFGVFHMRG-----IGGMA---------------- 86

  Fly   137 GWQLVCALRVVEGLCQGV-----VFPSTHTILSQWA 167
            |||.:..:..:..|..|:     :.||.......|:
Yeast    87 GWQWLFLIERIFTLVIGISAYFLMVPSVVQTKKPWS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15096NP_611376.1 2A0114euk 36..480 CDD:129972 22/101 (22%)
MFS 40..464 CDD:119392 22/101 (22%)
YOL163WNP_014479.1 MFS 1..>151 CDD:421695 22/101 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.