DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15096 and TNA1

DIOPT Version :9

Sequence 1:NP_611376.1 Gene:CG15096 / 37170 FlyBaseID:FBgn0034394 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_011776.1 Gene:TNA1 / 853175 SGDID:S000003492 Length:534 Species:Saccharomyces cerevisiae


Alignment Length:448 Identity:85/448 - (18%)
Similarity:164/448 - (36%) Gaps:108/448 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 NLSVAVVAMTDAASVNPDF----PEYNWSEKTKSLLLSSFFWGYVITQVPAGQLARKYGGKVMIL 116
            ||..:.:...:.|.::.|.    .:||       ..::.||..||:.. |.|....|..|..:::
Yeast   104 NLDKSNIGNAEVAGLSKDIHLVGTQYN-------TCVTVFFATYVLFD-PIGTNLLKIMGPPLMM 160

  Fly   117 SGLAIC-SILNILTPICAKIGGWQLVCALRVVEGLCQGVVFPSTHTILS------QWAPPKERAT 174
            |   || :....::...|.:..:..:..:|::.|..:|:::|:.:..||      |:|  ...|.
Yeast   161 S---ICLTCFGAISLGTAWVKNYAQLIVVRLLLGAFEGMIYPAINMYLSVCYRREQYA--LRFAF 220

  Fly   175 LGTCAYSGNQFGTILMLATSGVIAASPIGWPSIFYISGGIGCVWSVVYFFFGAGSPQECKSISAE 239
            :.:.|...:.||.::....| .|:.|...|..|:.:.|.|...:...|.|..:.:.::....:.|
Yeast   221 VFSAACLSSSFGGLIAYGCS-KISGSLKDWQYIYIVEGCISLGFVPFYAFGLSKNLEDSWFFNKE 284

  Fly   240 EKKLIE-----MSQADEVSGGQEQPKEQLPTPWLSFFTSPAFLVLIVSHSVHNWGFWTLLTEIPS 299
            ||:.|.     |:..|        |.|:.  .|..                    .|..:.::.:
Yeast   285 EKEYISERYKTMNTFD--------PDEKF--EWFQ--------------------VWQAVKDVKT 319

  Fly   300 YMKNI--LGKDIKSNALLSSLPYVCMFAMSFVFSSISAQLNNRN-----------CISRSTSRKL 351
            :...:  .|.|:.:..|...||.:   ..|..|:::.|||....           |...|...||
Yeast   320 WASAVALFGIDLTTFGLTVFLPII---ITSMGFTNVRAQLMTVPIYFLTAIVFFICAVWSDRIKL 381

  Fly   352 FNSIGLWIPMVTLVGLGYVNPDQSE----LAVVLLCFTVGMNG-----------------ATYLG 395
            .:...|...:.|.:|:..|...|..    ..|.:||..:.:|.                 ||.||
Yeast   382 RSPFILGACLTTSIGIAIVLGSQVHGVRYFGVYILCMGIYVNAACNCLWLSGNTGNYFKRATALG 446

  Fly   396 FN----------TNHIDLSPNFAGILMGITNGVA-NIMSIIAPLIVGFIVTNEHDPEQ 442
            .|          :..|.::.:....:.|::..:| .:.||...::..|:...|:|.::
Yeast   447 INLFFGSGSGLVSGQIFVAKDKPRYIKGLSISLAFQVFSIFMTVVQIFLYKRENDKKK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15096NP_611376.1 2A0114euk 36..480 CDD:129972 85/448 (19%)
MFS 40..464 CDD:119392 85/448 (19%)
TNA1NP_011776.1 MFS_FEN2_like 87..490 CDD:340885 82/432 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I2826
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I1824
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.