DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15096 and VHT1

DIOPT Version :9

Sequence 1:NP_611376.1 Gene:CG15096 / 37170 FlyBaseID:FBgn0034394 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_011579.1 Gene:VHT1 / 852956 SGDID:S000003297 Length:593 Species:Saccharomyces cerevisiae


Alignment Length:297 Identity:65/297 - (21%)
Similarity:118/297 - (39%) Gaps:73/297 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GYVITQVPAGQLARKYGGKVMILSGLAICSILNI----LTPICAKIGGWQLVCALRVVEGLCQGV 154
            |.::.|:|...|..::...:       |..::::    .|..|.:......:.|.|.:.......
Yeast   176 GAIVFQLPFMYLLPRFPSHI-------ILPVMDLGWTWFTFACYRANSLAELRAYRFILSAFGAA 233

  Fly   155 VFPSTHTILSQWAPPKE---RATLGTCAYSGNQFGTILMLATSGVIAA----------SPIGWPS 206
            .:|.:..||..|..|.|   |..|..|   |.|.|::    |||::.:          ...||..
Yeast   234 YYPVSQYILGCWYAPDEINSRVCLFFC---GQQLGSV----TSGLLQSRIFKSLNGVHGLAGWRW 291

  Fly   207 IFYISG-GIGCVWSVVYFFFGAGSPQECKSISAEEKKLIEMSQA----DEVSGGQEQPK------ 260
            :|.|.. .|....:::.||...|.|.:|.|:...::: |.:::|    :::..|.::.|      
Yeast   292 MFLIDAIAISLPTAIIGFFVIPGVPSKCYSLFLTDEE-IRIARARNKRNQIKDGVDKSKLAPLWS 355

  Fly   261 EQLPTPWLSFFTSPAFLVLIVSHSVHNW-------GFWTLLTEIPSYMKNILGKDIKSNALLSSL 318
            .:|   |...|.:|||.||:|..:. :|       |.:||      ::|:.....|.....||.:
Yeast   356 RKL---WKKVFCTPAFWVLVVFDTC-SWNNMTAYSGSYTL------WLKSNTKYSIAQVNNLSVI 410

  Fly   319 P------YV--C-----MFAMSFVFSSISAQLNNRNC 342
            |      ||  |     :|...::|...:|.:|..:|
Yeast   411 PACLGFAYVIFCAFGADLFRCKWIFMVFAAIMNTVSC 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15096NP_611376.1 2A0114euk 36..480 CDD:129972 65/297 (22%)
MFS 40..464 CDD:119392 65/297 (22%)
VHT1NP_011579.1 MFS_FEN2_like 124..542 CDD:340885 65/297 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.