DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15096 and Slc17a9

DIOPT Version :9

Sequence 1:NP_611376.1 Gene:CG15096 / 37170 FlyBaseID:FBgn0034394 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_038961483.1 Gene:Slc17a9 / 362287 RGDID:1311940 Length:448 Species:Rattus norvegicus


Alignment Length:269 Identity:80/269 - (29%)
Similarity:129/269 - (47%) Gaps:38/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LLFFALTVAYGCRVNLSVAVVAMTDAASVNPDFPEYNWSEKTKSLLLSSFFWGYVITQVPAGQLA 106
            :|.....:.|..||.:.|..|||:.         ::.|::|...::||||||||.:|||..|.|.
  Rat    40 MLLLGTCLLYCTRVTMPVCTVAMSQ---------DFGWNKKEAGIVLSSFFWGYCLTQVVGGHLG 95

  Fly   107 RKYGGKVMILSGLAICSILNILTPICAKIGGWQL--VCALRVVEGLCQGVVFPSTHTILSQWAPP 169
            .:.||:.:||...:....:.:.||:.|.:|...|  |...|::.||.|||.||:..::|||....
  Rat    96 DRIGGEKVILLSASAWGFITVTTPLLAHLGSGHLAFVTFSRILTGLLQGVYFPALTSLLSQRVQE 160

  Fly   170 KERATLGTCAYSGNQFGTILMLATSGV--IAASPIGWPSIFYISGGIGCVWSVVYFFFGAGSPQE 232
            .||:...:...:|:|.||   |.|.|:  :.....||.|:||.|||:..:|  ||:.:       
  Rat   161 SERSFTYSTVGAGSQVGT---LVTGGIGSVLLDRCGWQSVFYFSGGLTLLW--VYYVY------- 213

  Fly   233 CKSISAEEKKLI----EMSQADEVSGGQEQPKEQLPTPWLSFFTSPAFLVLIVSHSVHNWGFWTL 293
              ....:||.|:    .::|...|:    :|.:   .||...|...:...:|.|.......|:.|
  Rat   214 --KYLLDEKDLVLALGVLAQGLPVT----RPSK---VPWRQLFRKASVWAVICSQLSSACSFFIL 269

  Fly   294 LTEIPSYMK 302
            |:.:|::.|
  Rat   270 LSWLPTFFK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15096NP_611376.1 2A0114euk 36..480 CDD:129972 80/269 (30%)
MFS 40..464 CDD:119392 80/269 (30%)
Slc17a9XP_038961483.1 MFS 38..>326 CDD:421695 80/269 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53923
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.