DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15096 and SLC17A8

DIOPT Version :9

Sequence 1:NP_611376.1 Gene:CG15096 / 37170 FlyBaseID:FBgn0034394 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_647480.1 Gene:SLC17A8 / 246213 HGNCID:20151 Length:589 Species:Homo sapiens


Alignment Length:495 Identity:151/495 - (30%)
Similarity:254/495 - (51%) Gaps:34/495 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GGSNGTMDMEAKNSNKEDEAVGKHS--------------------GLGVRHFQVLLLFFALTVAY 51
            |.|.|.:..:...:.:|::.:..:.                    ||..|:...::......:::
Human    26 GDSLGILQRKIDGTTEEEDNIELNEEGRPVQTSRPSPPLCDCHCCGLPKRYIIAIMSGLGFCISF 90

  Fly    52 GCRVNLSVAVVAMTDAASVNPD-FPE-----YNWSEKTKSLLLSSFFWGYVITQVPAGQLARKYG 110
            |.|.||.||:|.|.:.::|..| .||     :||..:|..|:..||||||::||:|.|.::.|:.
Human    91 GIRCNLGVAIVEMVNNSTVYVDGKPEIQTAQFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFA 155

  Fly   111 GKVMILSGLAICSILNILTPICAKIGGWQLVCALRVVEGLCQGVVFPSTHTILSQWAPPKERATL 175
            ...:..:.:.:.|.||:..|..|::....::| :|:::||.:||.:|:.|.:.|:||||.||:.|
Human   156 ANRVFGAAIFLTSTLNMFIPSAARVHYGCVMC-VRILQGLVEGVTYPACHGMWSKWAPPLERSRL 219

  Fly   176 GTCAYSGNQFGTILMLATSGVIAASPIGWPSIFYISGGIGCVWSVVYFFFGAGSPQECKSISAEE 240
            .|.::.|:..|.::.:..:||: ...|||.|:|||.|..|.:|.:.:.......|....:||.||
Human   220 ATTSFCGSYAGAVVAMPLAGVL-VQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEE 283

  Fly   241 KKLIEMSQADEVSGGQEQPKEQLPTPWLSFFTSPAFLVLIVSHSVHNWGFWTLLTEIPSYMKNIL 305
            |..||.|..:   |.......:..|||..||||.....:||::...:|.|:.||...|:|.:.:.
Human   284 KTYIETSIGE---GANVVSLSKFSTPWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVF 345

  Fly   306 GKDIKSNALLSSLPYVCMFAMSFVFSSISAQLNNRNCISRSTSRKLFNSIGLWIPMVTLVGLGYV 370
            |..|....|||::|::.|..:..:...::..|.:|..::.:..||:.|..|..:....|:.:|:.
Human   346 GFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFS 410

  Fly   371 NPDQSELAVVLLCFTVGMNGATYLGFNTNHIDLSPNFAGILMGITNGVANIMSIIAPLIVGFIVT 435
            :  ...:|:..|...||.:|....|||.||:|::|.:|.|||||:|||..:..::.||||| .:|
Human   411 H--TKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVG-AMT 472

  Fly   436 NEHDPEQWRIVFFIAAGFYLVGNTLYVIFGKANVQPWNDP 475
            .....|:|:.||.|||..:..|...|.:|.....|.|.||
Human   473 RHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEWADP 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15096NP_611376.1 2A0114euk 36..480 CDD:129972 145/446 (33%)
MFS 40..464 CDD:119392 139/429 (32%)
SLC17A8NP_647480.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..61 1/20 (5%)
2A0114euk 75..513 CDD:129972 145/446 (33%)
MFS 80..502 CDD:119392 139/429 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148605
Domainoid 1 1.000 49 1.000 Domainoid score I11776
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53923
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.