DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15096 and C06E7.88

DIOPT Version :9

Sequence 1:NP_611376.1 Gene:CG15096 / 37170 FlyBaseID:FBgn0034394 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001255275.2 Gene:C06E7.88 / 13194964 WormBaseID:WBGene00189995 Length:167 Species:Caenorhabditis elegans


Alignment Length:33 Identity:9/33 - (27%)
Similarity:18/33 - (54%) Gaps:2/33 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 ITNGVANIMSIIAPLIVGFIVTNEHDPEQWRIV 446
            :|..|..::..:..|.|.|.:.::|  .|||::
 Worm     1 MTRSVIILVICLVGLPVAFGLESKH--WQWRLI 31

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15096NP_611376.1 2A0114euk 36..480 CDD:129972 9/33 (27%)
MFS 40..464 CDD:119392 9/33 (27%)
C06E7.88NP_001255275.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.