DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15096 and slc17a7b

DIOPT Version :9

Sequence 1:NP_611376.1 Gene:CG15096 / 37170 FlyBaseID:FBgn0034394 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_009295917.2 Gene:slc17a7b / 100331980 ZFINID:ZDB-GENE-131125-32 Length:585 Species:Danio rerio


Alignment Length:450 Identity:147/450 - (32%)
Similarity:241/450 - (53%) Gaps:13/450 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GLGVRHFQVLLLFFALTVAYGCRVNLSVAVVAMTDAASVNPDFPEY------NWSEKTKSLLLSS 90
            ||..|:...:|......:::|.|.||.||||:|.:..:|..|...|      :|..:|..::..|
Zfish    58 GLPRRYIIAILSGLGFCISFGIRCNLGVAVVSMVNNHTVYRDGKPYIVKAQFSWDPETVGMIHGS 122

  Fly    91 FFWGYVITQVPAGQLARKYGGKVMILSGLAICSILNILTPICAKIGGWQLVCALRVVEGLCQGVV 155
            |||||::||:|.|.:.:|:....:....:...||||::.|..|:: .:..|..:|:::||.:||.
Zfish   123 FFWGYIVTQIPGGFICQKFAANRVFGFAVVSTSILNMMIPTAARM-HFGCVILVRILQGLVEGVS 186

  Fly   156 FPSTHTILSQWAPPKERATLGTCAYSGNQFGTILMLATSGVIAASPIGWPSIFYISGGIGCVWSV 220
            :|:.|.|.::||||.||:.|.|.|:.|:..|.::.:..:||:.... ||.|:||:.|..|..|.:
Zfish   187 YPACHGIWAKWAPPLERSRLATTAFCGSYAGAVIAMPLAGVLVQYS-GWSSVFYVYGSFGVCWYL 250

  Fly   221 VYFFFGAGSPQECKSISAEEKKLIEMSQADEVSGGQEQPKEQLPTPWLSFFTSPAFLVLIVSHSV 285
            .:......||....:|:.||:|.||  .|...|.|...|..:..|||..||||.....:||::..
Zfish   251 FWILVSYESPAAHPTITPEERKYIE--DAIGESAGLVNPLTKFNTPWRQFFTSMPVYAIIVANFC 313

  Fly   286 HNWGFWTLLTEIPSYMKNILGKDIKSNALLSSLPYVCMFAMSFVFSSISAQLNNRNCISRSTSRK 350
            .:|.|:.||...|:|.:.:...:|....:||:||::.|..:..:...::..|...|.::.:..||
Zfish   314 RSWTFYLLLISQPAYFEEVFKFEISKVGILSALPHLVMTIVVPIGGQLADYLRTHNLMTTTNVRK 378

  Fly   351 LFNSIGLWIPMVTLVGLGYVNPDQSELAVVLLCFTVGMNGATYLGFNTNHIDLSPNFAGILMGIT 415
            |.|..|..:....|:.:|:.:  ...:|:..|...||.:|....|||.||:|::|.:|.|||||:
Zfish   379 LMNCGGFGLEATFLLVVGFSH--TKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGIS 441

  Fly   416 NGVANIMSIIAPLIVGFIVTNEHDPEQWRIVFFIAAGFYLVGNTLYVIFGKANVQPWNDP 475
            |||..:..::.|||||.:..|: ..|:|:.||.||:..:..|...|.:|.....|||.:|
Zfish   442 NGVGTLSGMVCPLIVGAMTKNK-TREEWQYVFLIASLVHYGGVIFYGLFASGEKQPWAEP 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15096NP_611376.1 2A0114euk 36..480 CDD:129972 144/445 (32%)
MFS 40..464 CDD:119392 139/429 (32%)
slc17a7bXP_009295917.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582486
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53923
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.