DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JAK2 and fin1

DIOPT Version :9

Sequence 1:NP_001309123.1 Gene:JAK2 / 3717 HGNCID:6192 Length:1132 Species:Homo sapiens
Sequence 2:NP_593305.1 Gene:fin1 / 2542237 PomBaseID:SPAC19E9.02 Length:722 Species:Schizosaccharomyces pombe


Alignment Length:299 Identity:77/299 - (25%)
Similarity:144/299 - (48%) Gaps:65/299 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   850 KFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQ--HSTEEHLRDFEREIEILKSLQHDNIVK 912
            |.|:.:|.|:||.:  .:...|:|  |.::|.|::.  :.|.:..:....|:.||::|:|.|||:
pombe     5 KILECIGHGSFGRI--YKVQRLKD--GALLAQKEIHFGNITRQEKQYIADEVNILRNLKHPNIVQ 65

Human   913 YKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKE---RIDHIKLLQYTSQICKGM---------- 964
            |.|...:...:.:.|.|||..:|.|.:.:|::||   |....::|::.:|:...:          
pombe    66 YCGEELNRSAQVINLYMEYCGHGDLANLIQRYKEEKKRFTEQEVLKFFTQLLLALYRCHYGENAP 130

Human   965 --------EYLGTKR-YIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYK--VKEPGESPI 1018
                    |....|: .:|||:...||.::..|.||:|||||:|:|...:.:.:  |..|     
pombe   131 ACDSQWPREIFHPKQSVLHRDIKPANIFLDENNSVKLGDFGLSKLLDNTRVFTQSYVGTP----- 190

Human  1019 FWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLK 1083
            ::.:||.:..|.:|..||||:.|.|::|:.               |:.:..:|:    ..:||.:
pombe   191 YYMSPEIIRSSPYSAKSDVWALGCVIFEIC---------------MLTHPFEGR----SYLELQR 236

Human  1084 N--NGRLPRPDGC-----PDEIYMIMTECWNNNVNQRPS 1115
            |  .|.|    .|     .|::::::..|...|.:.||:
pombe   237 NICQGNL----SCWDHHYSDDVFLLIRHCLEVNSDLRPT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JAK2NP_001309123.1 Interaction with cytokine/interferon/growth hormone receptors. /evidence=ECO:0000250 1..239
B41 38..270 CDD:214604
FERM_C_JAK2 266..386 CDD:270141
SH2_Jak2 386..482 CDD:198242
PTK_Jak2_rpt1 545..806 CDD:270663
Pkinase_Tyr 545..805 CDD:285015
PTKc_Jak2_rpt2 844..1127 CDD:271107 77/299 (26%)
TyrKc 849..1119 CDD:197581 77/299 (26%)
fin1NP_593305.1 STKc_Nek2 3..281 CDD:270857 77/299 (26%)
S_TKc 4..281 CDD:214567 77/299 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.