DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JAK2 and mlk-1

DIOPT Version :9

Sequence 1:NP_001309123.1 Gene:JAK2 / 3717 HGNCID:6192 Length:1132 Species:Homo sapiens
Sequence 2:NP_001300151.1 Gene:mlk-1 / 178895 WormBaseID:WBGene00003374 Length:1059 Species:Caenorhabditis elegans


Alignment Length:462 Identity:119/462 - (25%)
Similarity:174/462 - (37%) Gaps:138/462 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   770 HQLPAPKW-----AELANLINNCMDYEPDFR------------PSFRAIIRDLNSLFTPDYELLT 817
            |..|.|:.     .|.....:...|..|:.|            |..||     :..|...||...
 Worm    23 HLAPTPEHHRSVSYEDTTTASTSTDSVPEVRIRSESSQVSRESPPIRA-----SKAFVASYEYEA 82

Human   818 ENDMLPNMRIGAL-------------------GFSGAFED---RDPTQFEERHLKFLQ------- 853
            :.|...|:.:||:                   |..|.|..   |:.| :::..::|.|       
 Worm    83 QKDDELNLPLGAIITLVTVETNEDGWYRGELNGKVGLFPSNYAREVT-YKDNLVEFKQDEIMLPV 146

Human   854 --------QLGKGNFGSV---EMCRYDPLQD-NTGEVV------AVKKLQH----------STEE 890
                    |:|.|...:|   ::.....||: ..||.|      |:|:...          ||:|
 Worm   147 AVRTLSDCQIGHGATATVFKMDIKIKKELQNGRMGEAVGDQMKAALKRFNRHASNFRADVVSTDE 211

Human   891 HLRDFEREIEILKSLQHDNIVKYKGVC----YSAGRRNLKLIMEYLPYGSLRDYLQ--KHKERID 949
            .|...:||..::..|.|:|||:..|:|    |      ..|::|.....|||:..:  .....|.
 Worm   212 QLEQLKREANLVNGLSHNNIVRLLGICLEDPY------FGLLLELCEGSSLRNVCRNLNSDAAIP 270

Human   950 HIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENE-------------------------NR 989
            ...|:.:.:|:.:|||||..:.|:||||...|:||:.|                         .:
 Worm   271 LGVLIDWATQVAEGMEYLTKQGYVHRDLKADNVLVKEEVCLCMDEEMFQYAYCLKCGKRPFDKLQ 335

Human   990 VKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKS 1054
            :||.|||:|:.:..|...:..    .....|.|||:..|..:|.||||||:||||:||.|..|..
 Worm   336 LKITDFGVTRKMTADANRFST----AGTYAWLAPEAFKEGTWSEASDVWSYGVVLWELLTREEPY 396

Human  1055 KSP-PAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRD 1118
            :.. ||.....|.|..|...|                .|.|||....:|.:|||...|.||.|..
 Worm   397 QGHIPATIAFQIANKGQNLSI----------------GDSCPDRWKKLMQDCWNLEPNFRPKFST 445

Human  1119 LALRVDQ 1125
            ||:...|
 Worm   446 LAISFKQ 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JAK2NP_001309123.1 Interaction with cytokine/interferon/growth hormone receptors. /evidence=ECO:0000250 1..239
B41 38..270 CDD:214604
FERM_C_JAK2 266..386 CDD:270141
SH2_Jak2 386..482 CDD:198242
PTK_Jak2_rpt1 545..806 CDD:270663 10/52 (19%)
Pkinase_Tyr 545..805 CDD:285015 10/51 (20%)
PTKc_Jak2_rpt2 844..1127 CDD:271107 97/349 (28%)
TyrKc 849..1119 CDD:197581 94/336 (28%)
mlk-1NP_001300151.1 SH3 75..124 CDD:302595 9/48 (19%)
STYKc 153..450 CDD:214568 94/322 (29%)
PKc_like 156..446 CDD:304357 91/315 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.