DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS15 and SLC17A1

DIOPT Version :9

Sequence 1:NP_611375.2 Gene:MFS15 / 37168 FlyBaseID:FBgn0034392 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_016866688.1 Gene:SLC17A1 / 6568 HGNCID:10929 Length:517 Species:Homo sapiens


Alignment Length:504 Identity:149/504 - (29%)
Similarity:220/504 - (43%) Gaps:87/504 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PCCNHNGYQQIGNTGP----------RFGVRHL-QCILVFFGLAVAYSLRVNLS-VAIVAMTDRN 59
            ||      .|:.|..|          |:|:..| .|..|   :..|....:||: |.:|..||.:
Human    49 PC------MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNV---IITAQRACLNLTMVVMVNSTDPH 104

  Fly    60 A----------SNPDFPEFDWNESTKSYLLSSFFWGYVVTQIPGGYLSAIYGAKYMLFYGVLICS 114
            .          .|...|.::|:...:..:|||..:|.::.|:|.||.|.||..|.|:.:.:.:.|
Human   105 GLPNTSTKKLLDNIKNPMYNWSPDIQGIILSSTSYGVIIIQVPVGYFSGIYSTKKMIGFALCLSS 169

  Fly   115 CLALLTPFCA-VNGGWTVVVVLRAVQGLCQGVIFPSTHTFLSKWAPAEERGRLVGYTYSGSQFGT 178
            .|:||.|..| :...|  |||.|||||..||::..:......||||..|||||...:.||...|.
Human   170 VLSLLIPPAAGIGVAW--VVVCRAVQGAAQGIVATAQFEIYVKWAPPLERGRLTSMSTSGFLLGP 232

  Fly   179 VVMLSVSGYIASSSLGWPSTFYIPGCVGIVWSFVWLYLCSSTPAQHPTITPNERRFIESSGQARR 243
            .::|.|:|.|. .|||||..|||.|..|.....:|..|....|..||.|:.:|:.:|.||  ..:
Human   233 FIVLLVTGVIC-ESLGWPMVFYIFGACGCAVCLLWFVLFYDDPKDHPCISISEKEYITSS--LVQ 294

  Fly   244 PSDAGREEQP----RPPTPWWRIFT-SVPFLVLVLAHCANNWGFW-----TLLTEIPTFMKNVLG 298
            ...:.|:..|    ....|.|.|.| |..|             ||     ||.|  |.|:.::|.
Human   295 QVSSSRQSLPIKAILKSLPVWAISTGSFTF-------------FWSHNIMTLYT--PMFINSMLH 344

  Fly   299 MDIKNNGPLSALPYFAMILLTCVFIW--------LSDTLKQRG--TVIPLGFSRKFFNTLGMWLP 353
            ::||.||.||:|||        :|.|        |||....|.  :||.:   ||.|...|..||
Human   345 VNIKENGFLSSLPY--------LFAWICGNLAGQLSDFFLTRNILSVIAV---RKLFTAAGFLLP 398

  Fly   354 MLALIGLGYITEGEANVRLAIGLLTAAVATNSATYLGFHVNHIDLSPNYAGTLMGITNCAANFMS 418
            .:..:.|.|::....::   :..|..|.||.|....|..:|.:|::|.|.|.:...:........
Human   399 AIFGVCLPYLSSTFYSI---VIFLILAGATGSFCLGGVFINGLDIAPRYFGFIKACSTLTGMIGG 460

  Fly   419 ILAPLIVGLIVWDETNPAQWRIVFFFTAFVYFIGNLLFMLFGRTRVQPW 467
            ::|..:.|||:..:...| |...|...|.:...|.:.:::.....:|.|
Human   461 LIASTLTGLILKQDPESA-WFKTFILMAAINVTGLIFYLIVATAEIQDW 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS15NP_611375.2 2A0114euk 18..469 CDD:129972 146/493 (30%)
MFS 31..459 CDD:119392 139/459 (30%)
SLC17A1XP_016866688.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148644
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.