DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS15 and CG7091

DIOPT Version :9

Sequence 1:NP_611375.2 Gene:MFS15 / 37168 FlyBaseID:FBgn0034392 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_650243.2 Gene:CG7091 / 41590 FlyBaseID:FBgn0038099 Length:509 Species:Drosophila melanogaster


Alignment Length:495 Identity:117/495 - (23%)
Similarity:204/495 - (41%) Gaps:60/495 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VRHLQCILVFFGLAVAYSLRVNLSVAIVAM------------------TDRNAS----------- 61
            ||....|..|....:..::|..|.:.|:.|                  |:.|.:           
  Fly    26 VRLTYAICAFLATCLHAAMRNMLGMIILKMVMPRPEDALVVPAGLSRLTEGNVTSTGRCGSPRVV 90

  Fly    62 -NPDFPE-----FDWNESTKSYLLSSFFWGYVVTQIPGGYLSAIYGAKYMLFYGVLICSCLALLT 120
             ||...|     ..|..:.:......:::||||:....|||:....:|.:....::..:...:|.
  Fly    91 FNPQIQETQSGDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAVAYILL 155

  Fly   121 PFCAVNGGWTVVVVLRAVQGLCQGVIFPSTHTFLSKWAPAEERGRLVGYTYSGSQFGTVVMLSVS 185
            |..| :..:...||...:.||..|...|:.:.....||...||..|:.:.|||...|::::..|:
  Fly   156 PAMA-HSSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTALLSFAYSGLLMGSMLVYPVA 219

  Fly   186 GYIASSSLGWPSTFYIPGCVGIVWSFVWLYLCSSTPAQHPTITPNERRFIESSGQARRPSDAGRE 250
            .|:  |:.||..:||:.|.||:.:.....:|...|..|||.|:..|..::...     .|..|::
  Fly   220 SYL--SNFGWELSFYVVGGVGLSFGIACCFLVYDTVEQHPRISNEEVDYLRQG-----KSQLGQQ 277

  Fly   251 EQPRPPTPWWRIFTSVPFLVLVLAHCANNWGFWTLLTEIPTFMKNVLGMDIKNNGPLSALPYFAM 315
            .||....||..:..:.|....:|.|..:.:.|..::..:|.||:..:..|::..|.|||.||...
  Fly   278 RQPVVTIPWKSLLAAPPVYAFILTHMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGG 342

  Fly   316 IL--LTCVFIWLSDTLKQRGTVIPLGFSRKFFNTLGMWLPMLALIGLGYITEGEANVRLAIGLLT 378
            |.  :.|:   |..:..:|.........|:....:...| ..:|||:..:...:..: |.:.:..
  Fly   343 ICSKVMCI---LGGSYVERRVGPDQNCVRRMLYGICSIL-TTSLIGVIILANCDDKI-LVLVMFA 402

  Fly   379 AAVATNSATYLGFHVNHIDLSPNYAGTLMGITNCAANFMSILAPLIVGLIVW----DETNPAQWR 439
            ..:||....:.|:....:..:|::||.|.|:.|..|:....|||.:|..:|.    ||.|.....
  Fly   403 FMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGMAHLSGFLAPHLVAALVHTGSKDEWNVVLMT 467

  Fly   440 IVFFFTAFVYFIGNLLFMLFGRTRVQPWNSRP-TTRTPSP 478
            ::.|.|     :..|:|.....|.:|||:.|. ..:|.||
  Fly   468 LIVFNT-----MAMLVFAFCSSTNLQPWDPRSRMEKTASP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS15NP_611375.2 2A0114euk 18..469 CDD:129972 113/483 (23%)
MFS 31..459 CDD:119392 107/468 (23%)
CG7091NP_650243.2 2A0114euk 77..498 CDD:129972 105/438 (24%)
MFS 115..482 CDD:119392 95/384 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm14983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.