DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS15 and Slc17a2

DIOPT Version :9

Sequence 1:NP_611375.2 Gene:MFS15 / 37168 FlyBaseID:FBgn0034392 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_038951630.1 Gene:Slc17a2 / 306950 RGDID:1308821 Length:487 Species:Rattus norvegicus


Alignment Length:476 Identity:148/476 - (31%)
Similarity:244/476 - (51%) Gaps:41/476 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VRHLQCILVFFGLAVAYSLRVNLSVAIVAM----------------------TDRNASNPDFPE- 67
            :|:...:::.|......:.||:||:||:||                      ::|:....||.. 
  Rat    25 LRYALALVMHFSNFTMITQRVSLSIAIIAMVNSTQHQDPANASAEGPVMNLLSNRSRGIKDFSTR 89

  Fly    68 ---FDWNESTKSYLLSSFFWGYVVTQIPGGYLSAIYGAKYMLFYGVLICSCLALLTPFCAVNGGW 129
               :.|:..|:..:.||..:|.::|.||.|||:.|:|||.:|..|:||.|.|.|.||. |.:.|.
  Rat    90 AAVYQWSTETQGIIFSSISYGIILTLIPSGYLAGIFGAKQILGAGLLISSLLTLFTPL-AADFGV 153

  Fly   130 TVVVVLRAVQGLCQGVIFPSTHTFLSKWAPAEERGRLVGYTYSGSQFGTVVMLSVSGYIASSSLG 194
            .:|:|:|.|||:.||:.:....|..:||||..||.:|.....||:.||:.::|.|.|.| |.:||
  Rat   154 ILVIVIRTVQGMAQGMSWTGQFTIWAKWAPPLERSKLTSIAGSGAAFGSFIILCVGGLI-SQALG 217

  Fly   195 WPSTFYIPGCVGIVWSFVWLYLCSSTPAQHPTITPNERRFIESSGQARRPSDAGREEQPRPPTPW 259
            ||..|||.|.:|.|...:|..:....|..||.|:..|:.:|.|       |.|.:...||...|.
  Rat   218 WPFIFYIFGSIGCVCCVLWFTMIYDDPMHHPCISVKEKEYITS-------SVAQQSSSPRRSIPI 275

  Fly   260 WRIFTSVPFLVLVLAHCANNWGFWTLLTEIPTFMKNVLGMDIKNNGPLSALPYFAMILLTCVFIW 324
            ..:...:|...:.:...::.|....::|.:||::..||.::|:::|.||:||:.|....|.:...
  Rat   276 KAMVRCLPLWAIFMGFFSHFWLCTIIITYLPTYISTVLHVNIRDSGVLSSLPFIAASSCTILGGQ 340

  Fly   325 LSDTLKQRGTVIPLGFSRKFFNTLGMWLPMLALIGLGYITEGEANVRLAIGLLTAAVATNSATYL 389
            ::|.|..| .::.|...||.|::||:.||.|..:.|.::|   ::....|.||.....|::....
  Rat   341 MADFLLSR-NLLSLITVRKLFSSLGLLLPSLCAVALPFVT---SSYIATIVLLILIPGTSNLCDS 401

  Fly   390 GFHVNHIDLSPNYAGTLMGITNCAANFMSILAPLIVGLIVWDETNPAQWRIVFFFTAFVYFIGNL 454
            ||.:|.:|::|.||..||||:........|::....|.:: .:.:.:.||.|||.:|.|...|.:
  Rat   402 GFIINTLDVAPRYASFLMGISRGFGLTAGIISSTTTGFLI-SQDSESGWRNVFFLSAAVNMFGLI 465

  Fly   455 LFMLFGRTRVQPW-NSRPTTR 474
            .:::||:..:|.| ..|..||
  Rat   466 FYLIFGQAEIQNWAKERTLTR 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS15NP_611375.2 2A0114euk 18..469 CDD:129972 145/469 (31%)
MFS 31..459 CDD:119392 140/453 (31%)
Slc17a2XP_038951630.1 MFS_SLC17 30..471 CDD:340876 140/454 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342551
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.