DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS15 and SPAC1002.16c

DIOPT Version :9

Sequence 1:NP_611375.2 Gene:MFS15 / 37168 FlyBaseID:FBgn0034392 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_593504.1 Gene:SPAC1002.16c / 2543262 PomBaseID:SPAC1002.16c Length:499 Species:Schizosaccharomyces pombe


Alignment Length:480 Identity:101/480 - (21%)
Similarity:173/480 - (36%) Gaps:120/480 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RVNLSVA-------IVAMTDR----NASNPDFPE-FDWNESTKSYLLSSFFWGYVVTQIPGGYLS 97
            |::|.:|       :||..||    ||.....|| ........:.:.|.|:..:::.::|...|.
pombe    54 RLDLVLAPTIMILYLVAFLDRSNIGNAKVAGLPEDLKLKGDQFNIIASVFYVTFILFEMPTTLLM 118

  Fly    98 AIYGAKYMLFYGVLICSCLALLTPFCAVNGGWTVVVVLRAVQGLCQGVIFPSTHTFLSKWAPAEE 162
            .....|.||.:.|:..|...:.|.||...||   ::..|.|.|.|:..:||....:|:......|
pombe   119 KKVQPKRMLAFIVISYSLTTIFTGFCHNFGG---LLAARLVLGFCEAGLFPCLALYLTMIYSRVE 180

  Fly   163 RGRLVGYTYSGS----------QFGTVVMLSVSGYIASSSLGWPSTFYIPGCVGIVWSFVWLYLC 217
            ....:.|.::.|          .:..:.|..|.|:     .||...|.|.|.:|.|.. |.:|. 
pombe   181 LAPRIAYLFASSALSGAFGGLFAYAVLHMDGVGGF-----AGWRWLFIIEGLIGFVCG-VAVYF- 238

  Fly   218 SSTPAQHPTITPNE----------RRFIESSGQARRPSD--AGREEQPRPPTPWWR----IFTSV 266
                     |.||:          .:.:....|..|.:|  |...:        |:    .||..
pombe   239 ---------IIPNDITKAWFLSKTHQEMMRKRQLERAADLEAAHFD--------WKGVKSAFTDF 286

  Fly   267 PFLVLVLAHCANN---WGFWTLLTEIPTFMKNVLGMDIKNNGPLS----ALPYFAMILLTCVFI- 323
            ...:..|:....:   :||.|.|..|      :.||...:   ||    .:|.:  ||....:| 
pombe   287 KVYLYALSEFGQDTCLYGFSTFLPAI------ISGMGYTS---LSVQYMTIPVY--ILGAATYIA 340

  Fly   324 --WLSDTLKQRGTVIPLGFSRKFFNTLGMWLPMLALIGLGYITEGEANVRLAIGLLTAAVATNSA 386
              :|||....||.::          .:|...|::..|.|......::.:..|..|.:..|.|.: 
pombe   341 ASFLSDRFHHRGIIL----------IIGNIFPIVGYILLLACQNNKSVLYFACYLCSVGVYTGA- 394

  Fly   387 TYLGFHVNHI--DLSPNY-AGTLMGITNCAANFMSILA--------PLIVGLIVWDETNPAQWRI 440
               |.:|..:  :::|:| ..|.:.:....||...|||        ..|.|.:.         .:
pombe   395 ---GLNVTWLSANIAPHYKRATAISLQLAIANSSGILAGQIYRYPPKYIAGHLT---------SL 447

  Fly   441 VFFFTAFVYFIGNLLFMLFGRTRVQ 465
            :..|.:.|..:.|:.|:....::.|
pombe   448 IAIFISTVLHVVNIFFLKHQNSKKQ 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS15NP_611375.2 2A0114euk 18..469 CDD:129972 101/480 (21%)
MFS 31..459 CDD:119392 100/472 (21%)
SPAC1002.16cNP_593504.1 MFS 63..455 CDD:119392 94/452 (21%)
2A0114 65..435 CDD:273326 91/421 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.