DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS15 and Slc17a1

DIOPT Version :9

Sequence 1:NP_611375.2 Gene:MFS15 / 37168 FlyBaseID:FBgn0034392 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_598238.2 Gene:Slc17a1 / 171080 RGDID:620099 Length:465 Species:Rattus norvegicus


Alignment Length:466 Identity:151/466 - (32%)
Similarity:227/466 - (48%) Gaps:32/466 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RFGVRHLQCILVFFGLAVAYSLRVNLSVAIVAMTDR-------NAS------NPDFPEFDWNEST 74
            |:|:    .||:.|...|..:.||.|::.:|||.::       |.|      |...|...|:...
  Rat    17 RYGL----AILLHFCNIVIMAQRVCLNLTMVAMVNKTEPPHLSNKSVAEMLDNVKNPVHSWSLDI 77

  Fly    75 KSYLLSSFFWGYVVTQIPGGYLSAIYGAKYMLFYGVLICSCLALLTPFCAVNGGWTVVVVLRAVQ 139
            :..:|||.|.|.||.|:|.||||..|..|.::...:.:.|.|:||.| .|...|..:|:|.|.:|
  Rat    78 QGLILSSVFLGMVVIQVPVGYLSGAYPMKKIIGSSLFLSSVLSLLIP-PAAQVGAALVIVCRVLQ 141

  Fly   140 GLCQGVIFPSTHTFLSKWAPAEERGRLVGYTYSGSQFGTVVMLSVSGYIASSSLGWPSTFYIPGC 204
            |:.||.:....|....||||..|||||...|.||...|..:.|.|||:|. ..||||..|||.|.
  Rat   142 GIAQGAVSTGQHGIWVKWAPPLERGRLTSMTLSGFVMGPFIALLVSGFIC-DLLGWPMVFYIFGI 205

  Fly   205 VGIVWSFVWLYLCSSTPAQHPTITPNERRFIESSGQARRPSDAGREEQPRPPTPWWRIFTSVPFL 269
            ||.|.|..|..|....|..||.::.:|:.:|.||  ..:...:||:..|..     .:..|:|..
  Rat   206 VGCVLSLFWFILFFDDPNNHPYMSSSEKDYITSS--LMQQVHSGRQSLPIK-----AMLKSLPLW 263

  Fly   270 VLVLAHCANNWGFWTLLTEIPTFMKNVLGMDIKNNGPLSALPYFAMILLTCVFIWLSDTLKQRGT 334
            .::|...|..|....|:|..|||:...|.::::.||.||:|||....:...|...:||.|..| .
  Rat   264 AIILNSFAFIWSNNLLVTYTPTFISTTLHVNVRENGLLSSLPYLLAYICGIVAGQMSDFLLSR-K 327

  Fly   335 VIPLGFSRKFFNTLGMWLPMLALIGLGYITEGEANVRLAIGLLTAAVATNSATYLGFHVNHIDLS 399
            :..:...||.|.|||::.|::.::.|.|::   .|....:..||.|.:|.|.::.|..:|.:|::
  Rat   328 IFSVVAVRKLFTTLGIFCPVIFVVCLLYLS---YNFYSTVIFLTLANSTLSFSFCGQLINALDIA 389

  Fly   400 PNYAGTLMGITNCAANFMSILAPLIVGLIVWDETNPAQWRIVFFFTAFVYFIGNLLFMLFGRTRV 464
            |.|.|.|..:|.....|..:::..:.|||:..:...| |...||..|.:.......::||.:..:
  Rat   390 PRYYGFLKAVTALIGIFGGLISSTLAGLILNQDPEYA-WHKNFFLMAGINVTCLAFYLLFAKGDI 453

  Fly   465 QPW-NSRPTTR 474
            |.| ....|||
  Rat   454 QDWAKETKTTR 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS15NP_611375.2 2A0114euk 18..469 CDD:129972 148/459 (32%)
MFS 31..459 CDD:119392 142/440 (32%)
Slc17a1NP_598238.2 2A0114euk 1..464 CDD:129972 149/464 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.